General Information of Drug Off-Target (DOT) (ID: OTQZ6HX0)

DOT Name Salivary acidic proline-rich phosphoprotein 1/2 (PRH1)
Synonyms Db-s; PRP-1/PRP-2; Parotid acidic protein; Pa; Parotid double-band protein; Parotid isoelectric focusing variant protein; PIF-S; Parotid proline-rich protein 1/2; Pr1/Pr2; Protein C
Gene Name PRH1
Related Disease
Pseudotumor cerebri ( )
Beta-thalassemia major ( )
Cerebral palsy ( )
Coagulation defect ( )
Congenital vertical talus ( )
Dental caries ( )
Familial hypertrophic cardiomyopathy ( )
Hepatitis C virus infection ( )
Hypercholesterolemia, familial, 1 ( )
Hypertrophic cardiomyopathy ( )
Isolated cleft palate ( )
Myocardial infarction ( )
Myositis disease ( )
Pulmonary fibrosis ( )
Stroke ( )
Thrombophilia ( )
Arthrogryposis ( )
High blood pressure ( )
Myopathy ( )
Cardiomyopathy ( )
Disseminated intravascular coagulation ( )
UniProt ID
PRPC_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15240
Sequence
MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSA
GDGNQNDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRP
PRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ
Function PRP's act as highly potent inhibitors of crystal growth of calcium phosphates. They provide a protective and reparative environment for dental enamel which is important for the integrity of the teeth.
KEGG Pathway
Salivary secretion (hsa04970 )

Molecular Interaction Atlas (MIA) of This DOT

21 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Pseudotumor cerebri DISLLY7S Definitive Genetic Variation [1]
Beta-thalassemia major DISW06BV Strong Biomarker [2]
Cerebral palsy DIS82ODL Strong Biomarker [3]
Coagulation defect DIS9X3H6 Strong Biomarker [4]
Congenital vertical talus DISZF3HD Strong Genetic Variation [5]
Dental caries DISRBCMD Strong Genetic Variation [6]
Familial hypertrophic cardiomyopathy DISQ89HN Strong Genetic Variation [7]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [8]
Hypercholesterolemia, familial, 1 DISU411W Strong Genetic Variation [7]
Hypertrophic cardiomyopathy DISQG2AI Strong Altered Expression [9]
Isolated cleft palate DISV80CD Strong Biomarker [3]
Myocardial infarction DIS655KI Strong Biomarker [10]
Myositis disease DISCIXF0 Strong Biomarker [11]
Pulmonary fibrosis DISQKVLA Strong Altered Expression [12]
Stroke DISX6UHX Strong Biomarker [13]
Thrombophilia DISQR7U7 Strong Genetic Variation [14]
Arthrogryposis DISC81CM moderate Biomarker [15]
High blood pressure DISY2OHH moderate Biomarker [16]
Myopathy DISOWG27 moderate Biomarker [15]
Cardiomyopathy DISUPZRG Limited Genetic Variation [17]
Disseminated intravascular coagulation DISCAVOZ Limited Altered Expression [18]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Salivary acidic proline-rich phosphoprotein 1/2 (PRH1). [19]
Ciclosporin DMAZJFX Approved Ciclosporin increases the methylation of Salivary acidic proline-rich phosphoprotein 1/2 (PRH1). [20]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Aspirin DM672AH Approved Aspirin decreases the expression of Salivary acidic proline-rich phosphoprotein 1/2 (PRH1). [21]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Salivary acidic proline-rich phosphoprotein 1/2 (PRH1). [22]
------------------------------------------------------------------------------------

References

1 Genetic Survey of Adult-Onset Idiopathic Intracranial Hypertension.J Neuroophthalmol. 2019 Mar;39(1):50-55. doi: 10.1097/WNO.0000000000000648.
2 Low levels of coagulation inhibitors: A high-risk thrombotic factor in thalassemic patients.Rev Clin Esp (Barc). 2020 Apr;220(3):162-166. doi: 10.1016/j.rce.2019.05.012. Epub 2019 Oct 2.
3 Sodium butyrate ameliorates Corynebacterium pseudotuberculosis infection in RAW264.7 macrophages and C57BL/6 mice.Microb Pathog. 2019 Jun;131:144-149. doi: 10.1016/j.micpath.2019.04.008. Epub 2019 Apr 6.
4 Variation of endothelium-related hemostatic factors during sepsis.Microcirculation. 2018 Nov;25(8):e12500. doi: 10.1111/micc.12500. Epub 2018 Oct 10.
5 Inherited protein-C deficiency, factor V G 1691 A and FV A 4070 G mutations in a child with internal cerebral venous thrombosis.Pediatr Radiol. 2000 Jun;30(6):420-3. doi: 10.1007/s002470050776.
6 Genetic- and Lifestyle-dependent Dental Caries Defined by the Acidic Proline-rich Protein Genes PRH1 and PRH2.EBioMedicine. 2017 Dec;26:38-46. doi: 10.1016/j.ebiom.2017.11.019. Epub 2017 Nov 22.
7 Mutations in beta-myosin S2 that cause familial hypertrophic cardiomyopathy (FHC) abolish the interaction with the regulatory domain of myosin-binding protein-C.J Mol Biol. 1999 Feb 26;286(3):933-49. doi: 10.1006/jmbi.1998.2522.
8 Peripheral B cells may serve as a reservoir for persistent hepatitis C virus infection.J Innate Immun. 2010;2(6):607-17. doi: 10.1159/000317690. Epub 2010 Aug 17.
9 Variable cardiac myosin binding protein-C expression in the myofilaments due to MYBPC3 mutations in hypertrophic cardiomyopathy.J Mol Cell Cardiol. 2018 Oct;123:59-63. doi: 10.1016/j.yjmcc.2018.08.023. Epub 2018 Aug 28.
10 Cardiac myosin binding protein-C is a potential diagnostic biomarker for myocardial infarction.J Mol Cell Cardiol. 2012 Jan;52(1):154-64. doi: 10.1016/j.yjmcc.2011.09.011. Epub 2011 Sep 19.
11 Autoantibodies in canine masticatory muscle myositis recognize a novel myosin binding protein-C family member.J Immunol. 2007 Oct 1;179(7):4939-44. doi: 10.4049/jimmunol.179.7.4939.
12 Citrus Alkaline Extract Delayed the Progression of Pulmonary Fibrosis by Inhibiting p38/NF-B Signaling Pathway-Induced Cell Apoptosis.Evid Based Complement Alternat Med. 2019 Feb 4;2019:1528586. doi: 10.1155/2019/1528586. eCollection 2019.
13 Thrombomodulin Ala455Val Polymorphism and the risk of cerebral infarction in a biracial population: the Stroke Prevention in Young Women Study.BMC Neurol. 2004 Dec 1;4(1):21. doi: 10.1186/1471-2377-4-21.
14 Risk Factors for Thrombosis Development in Mexican Patients.Ann Vasc Surg. 2015 Nov;29(8):1625-32. doi: 10.1016/j.avsg.2015.05.035. Epub 2015 Aug 24.
15 Myosin Binding Protein-C Slow Phosphorylation is Altered in Duchenne Dystrophy and Arthrogryposis Myopathy in Fast-Twitch Skeletal Muscles.Sci Rep. 2015 Aug 19;5:13235. doi: 10.1038/srep13235.
16 Molecular mechanisms of neuronal nitric oxide synthase in cardiac function and pathophysiology.J Physiol. 2014 Aug 1;592(15):3189-200. doi: 10.1113/jphysiol.2013.270306. Epub 2014 Apr 22.
17 Altered interactions between cardiac myosin binding protein-C and -cardiac actin variants associated with cardiomyopathies.Arch Biochem Biophys. 2014 May 15;550-551:28-32. doi: 10.1016/j.abb.2014.04.003. Epub 2014 Apr 13.
18 A novel fibrinogenase from Agkistrodon acutus venom protects against DIC via direct degradation of thrombosis and activation of protein C.Biochem Pharmacol. 2012 Oct 1;84(7):905-13. doi: 10.1016/j.bcp.2012.06.011. Epub 2012 Jun 20.
19 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
20 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
21 Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
22 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.