Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSG9EUS)

DOT Name Secernin-2 (SCRN2)
Gene Name SCRN2
Related Disease
Oculocerebrorenal syndrome ( )
Obesity ( )
UniProt ID
SCRN2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF03577
Sequence
MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGTHTPGSRLQCT
YIEVEQVSKTHAVILSRPSWLWGAEMGANEHGVCIGNEAVWTKEPVGEGEALLGMDLLRL
ALERSSSAQEALHVITGLLEHYGQGGNCLEDAAPFSYHSTFLLADRTEAWVLETAGRLWA
AQRIQEGARNISNQLSIGTDISAQHPELRTHAQAKGWWDGQGAFDFAQIFSLTQQPVRME
AAKARFQAGRELLRQRQGGITAEVMMGILRDKESGICMDSGGFRTTASMVSVLPQDPTQP
CVHFLTATPDPSRSVFKPFIFGMGVAQAPQVLSPTFGAQDPVRTLPRFQTQVDRRHTLYR
GHQAALGLMERDQDRGQQLQQKQQDLEQEGLEATQGLLAGEWAPPLWELGSLFQAFVKRE
SQAYA

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Oculocerebrorenal syndrome DIS8TEDY Strong Biomarker [1]
Obesity DIS47Y1K moderate Altered Expression [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Secernin-2 (SCRN2). [3]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Secernin-2 (SCRN2). [8]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Secernin-2 (SCRN2). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Secernin-2 (SCRN2). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Secernin-2 (SCRN2). [6]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Secernin-2 (SCRN2). [7]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Secernin-2 (SCRN2). [9]
Menadione DMSJDTY Approved Menadione affects the expression of Secernin-2 (SCRN2). [9]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Secernin-2 (SCRN2). [10]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Secernin-2 (SCRN2). [11]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Secernin-2 (SCRN2). [12]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Secernin-2 (SCRN2). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Two closely related endocytic proteins that share a common OCRL-binding motif with APPL1.Proc Natl Acad Sci U S A. 2010 Feb 23;107(8):3511-6. doi: 10.1073/pnas.0914658107. Epub 2010 Feb 2.
2 The association between obesity and race among Brazilian adults is dependent on sex and socio-economic status.Public Health Nutr. 2018 Aug;21(11):2096-2102. doi: 10.1017/S1368980018000307. Epub 2018 Mar 4.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
8 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
9 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
10 Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
11 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
12 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
13 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.