General Information of Drug Off-Target (DOT) (ID: OTSJOZ3O)

DOT Name FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2)
Synonyms Endoplasmic reticulum flavoprotein associated with degradation
Gene Name FOXRED2
UniProt ID
FXRD2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13738
Sequence
MGLSAAAPLWGPPGLLLAIALHPALSVPPRRDYCVLGAGPAGLQMAYFLQRAGRDYAVFE
RAPRPGSFFTRYPRHRKLISINKRYTGKANAEFNLRHDWNSLLSHDPRLLFRHYSRAYFP
DARDMVRYLGDFADTLGLRVQYNTTIAHVTLDKDRQAWNGHYFILTDQKGQVHQCSVLFV
ATGLSVPNQVDFPGSEYAEGYESVSVDPEDFVGQNVLILGRGNSAFETAENILGVTNFIH
MLSRSRVRLSWATHYVGDLRAINNGLLDTYQLKSLDGLLESDLTDLAILKDSKGKFHVTP
KFFLEEANTNQSADSITLPQDDNDNFAMRVPYDRVIRCLGWNFDFSIFNKSLRLNSGNAF
GKKYPLIRASYESKGSRGLFILGTASHSVDYRKSAGGFIHGFRYTVRAVHRLLEHRHHSV
TWPATELPITQLTSSIVRRVNEASGLYQMFGVLADVILLKENSTAFEYLEEFPIQMLAQL
ETLTGRKAKHGLFVINMEYGRNFSGPDKDVFFDDRSVGHTEDAWQSNFLHPVIYYYRYLP
TEQEVRFRPAHWPLPRPTAIHHIVEDFLTDWTAPIGHILPLRRFLENCLDTDLRSFYAES
CFLFALTRQKLPPFCQQGYLRMQGLVSTESLWQHRVESRLLRDYAPTGRRLEDSSQQLGD
QEPLGSPLAPGPLAQSVDSNKEEL
Function
Probable flavoprotein which may function in endoplasmic reticulum associated degradation (ERAD). May bind non-native proteins in the endoplasmic reticulum and target them to the ubiquitination machinery for subsequent degradation.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [1]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [13]
------------------------------------------------------------------------------------
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [6]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [7]
Testosterone DM7HUNW Approved Testosterone decreases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [8]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [9]
Marinol DM70IK5 Approved Marinol increases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [10]
Folic acid DMEMBJC Approved Folic acid decreases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [11]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [12]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of FAD-dependent oxidoreductase domain-containing protein 2 (FOXRED2). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
7 Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
8 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
9 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
10 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
11 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
12 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
13 Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
14 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
15 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.