Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSRFFUV)

• DOT Name: Swi5-dependent recombination DNA repair protein 1 homolog (SFR1)
• Synonyms: Meiosis protein 5 homolog
• Gene Name: SFR1
• Related Disease:
  Breast cancer
  Breast carcinoma
• UniProt ID: SFR1_HUMAN
• Pfam ID: PF10376
• Sequence:
  MAEGEKNQDFTFKMESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRF
  SFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLK
  NLNVCESQSLDSGSCSALQNEFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYR
  SKNDLSQLQLLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSEE
  EFIDV
• Function: Component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination. Acts as a transcriptional modulator for ESR1.
• Tissue Specificity: Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	moderate	Biomarker	[1]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[1]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Swi5-dependent recombination DNA repair protein 1 homolog (SFR1).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Swi5-dependent recombination DNA repair protein 1 homolog (SFR1).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Swi5-dependent recombination DNA repair protein 1 homolog (SFR1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Swi5-dependent recombination DNA repair protein 1 homolog (SFR1).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Swi5-dependent recombination DNA repair protein 1 homolog (SFR1).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Swi5-dependent recombination DNA repair protein 1 homolog (SFR1).	[7]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Swi5-dependent recombination DNA repair protein 1 homolog (SFR1).	[8]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Swi5-dependent recombination DNA repair protein 1 homolog (SFR1).	[9]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Swi5-dependent recombination DNA repair protein 1 homolog (SFR1).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Swi5-dependent recombination DNA repair protein 1 homolog (SFR1).	[11]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Swi5-dependent recombination DNA repair protein 1 homolog (SFR1).	[12]

References

• [1] DNA homologous recombination factor SFR1 physically and functionally interacts with estrogen receptor alpha.PLoS One. 2013 Jul 9;8(7):e68075. doi: 10.1371/journal.pone.0068075. Print 2013.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [7] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [8] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [9] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [10] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [11] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [12] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.