General Information of Drug Off-Target (DOT) (ID: OTT6Z3XS)

DOT Name Carbonic anhydrase 13 (CA13)
Synonyms EC 4.2.1.1; Carbonate dehydratase XIII; Carbonic anhydrase XIII; CA-XIII
Gene Name CA13
UniProt ID
CAH13_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3CZV; 3D0N; 3DA2; 4HU1; 4KNM; 4KNN; 4QIZ; 4QJP; 4QJX; 4QSJ; 5E2N; 5LLA; 5LLN; 5OGJ; 5OHH; 6G5U
EC Number
4.2.1.1
Pfam ID
PF00194
Sequence
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNF
DLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Function Reversible hydration of carbon dioxide.
Tissue Specificity Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis.
KEGG Pathway
Nitrogen metabolism (hsa00910 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Reversible hydration of carbon dioxide (R-HSA-1475029 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Carbonic anhydrase 13 (CA13). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Carbonic anhydrase 13 (CA13). [2]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Carbonic anhydrase 13 (CA13). [3]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Carbonic anhydrase 13 (CA13). [5]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Carbonic anhydrase 13 (CA13). [6]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Carbonic anhydrase 13 (CA13). [7]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Carbonic anhydrase 13 (CA13). [10]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Carbonic anhydrase 13 (CA13). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Carbonic anhydrase 13 (CA13). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Carbonic anhydrase 13 (CA13). [8]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Carbonic anhydrase 13 (CA13). [9]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
5 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
6 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
7 Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
10 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
11 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.