Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTEP531)

• DOT Name: Sterile alpha motif domain-containing protein 13 (SAMD13)
• Synonyms: SAM domain-containing protein 13
• Gene Name: SAMD13
• UniProt ID: SAM13_HUMAN
• Pfam ID: PF00536
• Sequence:
  MANSLLEGVFAEVKEPCSLPMLSVDMENKENGSVGVKNSMENGRPPDPADWAVMDVVNYF
  RTVGFEEQASAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNN
  SS

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Sterile alpha motif domain-containing protein 13 (SAMD13).	[1]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Sterile alpha motif domain-containing protein 13 (SAMD13).	[2]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Sterile alpha motif domain-containing protein 13 (SAMD13).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Sterile alpha motif domain-containing protein 13 (SAMD13).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Sterile alpha motif domain-containing protein 13 (SAMD13).	[3]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Sterile alpha motif domain-containing protein 13 (SAMD13).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Sterile alpha motif domain-containing protein 13 (SAMD13).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Sterile alpha motif domain-containing protein 13 (SAMD13).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Sterile alpha motif domain-containing protein 13 (SAMD13).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Sterile alpha motif domain-containing protein 13 (SAMD13).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Sterile alpha motif domain-containing protein 13 (SAMD13).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [4] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [5] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [8] Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.
• [9] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.