General Information of Drug Off-Target (DOT) (ID: OTU2M1BC)

DOT Name Serine/threonine-protein kinase VRK1
Synonyms EC 2.7.11.1; Vaccinia-related kinase 1
Gene Name VRK1
Related Disease
Pontocerebellar hypoplasia type 1A ( )
Microcephaly-complex motor and sensory axonal neuropathy syndrome ( )
Pontocerebellar hypoplasia type 1 ( )
UniProt ID
VRK1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2KTY; 2KUL; 2LAV; 2RSV; 3OP5; 5UKF; 5UVF; 6AC9; 6BP0; 6BRU; 6BTW; 6BU6; 6CFM; 6CMM; 6CNX; 6CQH; 6CSW; 6DD4; 6NPN; 6VXU; 6VZH; 7M10; 7TAN; 8F8Y
EC Number
2.7.11.1
Pfam ID
PF00069
Sequence
MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSE
SVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHD
KNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKA
SNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIA
KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKK
EIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
Function
Serine/threonine kinase involved in cell cycle, nuclear condensation and transcription regulation. Involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates KAT5 in response to DNA damage, promoting KAT5 association with chromatin and histone acetyltransferase activity. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity.
Tissue Specificity Widely expressed. Highly expressed in fetal liver, testis and thymus.
Reactome Pathway
Initiation of Nuclear Envelope (NE) Reformation (R-HSA-2995383 )
Nuclear Envelope Breakdown (R-HSA-2980766 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Pontocerebellar hypoplasia type 1A DIS7X0VS Strong Autosomal recessive [1]
Microcephaly-complex motor and sensory axonal neuropathy syndrome DISNZ80C Supportive Autosomal recessive [2]
Pontocerebellar hypoplasia type 1 DISU1PSQ Supportive Autosomal recessive [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
20 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Serine/threonine-protein kinase VRK1. [4]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Serine/threonine-protein kinase VRK1. [5]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Serine/threonine-protein kinase VRK1. [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Serine/threonine-protein kinase VRK1. [7]
Quercetin DM3NC4M Approved Quercetin increases the expression of Serine/threonine-protein kinase VRK1. [8]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Serine/threonine-protein kinase VRK1. [9]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Serine/threonine-protein kinase VRK1. [9]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Serine/threonine-protein kinase VRK1. [10]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Serine/threonine-protein kinase VRK1. [11]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Serine/threonine-protein kinase VRK1. [12]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Serine/threonine-protein kinase VRK1. [13]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of Serine/threonine-protein kinase VRK1. [14]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Serine/threonine-protein kinase VRK1. [15]
GSK2110183 DMZHB37 Phase 2 GSK2110183 decreases the expression of Serine/threonine-protein kinase VRK1. [16]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Serine/threonine-protein kinase VRK1. [5]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Serine/threonine-protein kinase VRK1. [17]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Serine/threonine-protein kinase VRK1. [19]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Serine/threonine-protein kinase VRK1. [20]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Serine/threonine-protein kinase VRK1. [21]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of Serine/threonine-protein kinase VRK1. [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Serine/threonine-protein kinase VRK1. [18]
------------------------------------------------------------------------------------

References

1 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
2 Mutations in VRK1 associated with complex motor and sensory axonal neuropathy plus microcephaly. JAMA Neurol. 2013 Dec;70(12):1491-8. doi: 10.1001/jamaneurol.2013.4598.
3 Spinal muscular atrophy with pontocerebellar hypoplasia is caused by a mutation in the VRK1 gene. Am J Hum Genet. 2009 Aug;85(2):281-9. doi: 10.1016/j.ajhg.2009.07.006. Epub 2009 Jul 30.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
7 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
10 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
11 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
12 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
13 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
14 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
15 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
16 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
17 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
18 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
19 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
20 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
21 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.