General Information of Drug Off-Target (DOT) (ID: OTUEZLO8)

DOT Name NUAK family SNF1-like kinase 2 (NUAK2)
Synonyms EC 2.7.11.1; Omphalocele kinase 2; SNF1/AMP kinase-related kinase; SNARK
Gene Name NUAK2
Related Disease
Anencephaly 2 ( )
UniProt ID
NUAK2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.7.11.1
Pfam ID
PF00069
Sequence
MESLVFARRSGPTPSAAELARPLAEGLIKSPKPLMKKQAVKRHHHKHNLRHRYEFLETLG
KGTYGKVKKARESSGRLVAIKSIRKDKIKDEQDLMHIRREIEIMSSLNHPHIIAIHEVFE
NSSKIVIVMEYASRGDLYDYISERQQLSEREARHFFRQIVSAVHYCHQNRVVHRDLKLEN
ILLDANGNIKIADFGLSNLYHQGKFLQTFCGSPLYASPEIVNGKPYTGPEVDSWSLGVLL
YILVHGTMPFDGHDHKILVKQISNGAYREPPKPSDACGLIRWLLMVNPTRRATLEDVASH
WWVNWGYATRVGEQEAPHEGGHPGSDSARASMADWLRRSSRPLLENGAKVCSFFKQHAPG
GGSTTPGLERQHSLKKSRKENDMAQSLHSDTADDTAHRPGKSNLKLPKGILKKKVSASAE
GVQEDPPELSPIPASPGQAAPLLPKKGILKKPRQRESGYYSSPEPSESGELLDAGDVFVS
GDPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPS
GAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPL
GDSCFSLTDCQEVTATYRQALRVCSKLT
Function
Stress-activated kinase involved in tolerance to glucose starvation. Induces cell-cell detachment by increasing F-actin conversion to G-actin. Expression is induced by CD95 or TNF-alpha, via NF-kappa-B. Protects cells from CD95-mediated apoptosis and is required for the increased motility and invasiveness of CD95-activated tumor cells. Phosphorylates LATS1 and LATS2. Plays a key role in neural tube closure during embryonic development through LATS2 phosphorylation and regulation of the nuclear localization of YAP1 a critical downstream regulatory target in the Hippo signaling pathway.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Anencephaly 2 DIS1V1OE Limited Autosomal recessive [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
17 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [2]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [5]
Temozolomide DMKECZD Approved Temozolomide increases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [7]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [8]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of NUAK family SNF1-like kinase 2 (NUAK2). [9]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [10]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [2]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [12]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [13]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [16]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [2]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [17]
QUERCITRIN DM1DH96 Investigative QUERCITRIN decreases the expression of NUAK family SNF1-like kinase 2 (NUAK2). [18]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of NUAK family SNF1-like kinase 2 (NUAK2). [6]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of NUAK family SNF1-like kinase 2 (NUAK2). [15]
------------------------------------------------------------------------------------

References

1 A loss-of-function NUAK2 mutation in humans causes anencephaly due to impaired Hippo-YAP signaling. J Exp Med. 2020 Dec 7;217(12):e20191561. doi: 10.1084/jem.20191561.
2 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
3 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
4 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
7 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
8 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
9 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
10 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
11 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
12 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
13 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
14 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
15 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
16 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
17 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
18 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.