General Information of Drug Off-Target (DOT) (ID: OTUIOEU3)

DOT Name Erythropoietin receptor (EPOR)
Synonyms EPO-R
Gene Name EPOR
Related Disease
Primary familial polycythemia due to EPO receptor mutation ( )
UniProt ID
EPOR_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1CN4; 1EBA; 1EBP; 1EER; 1ERN; 2JIX; 2MV6; 4Y5V; 4Y5X; 4Y5Y; 6E2Q; 6MOE; 6MOF; 6MOH; 6MOI; 6MOJ; 6MOK; 6MOL
Pfam ID
PF09067 ; PF00041
Sequence
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDL
VCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRY
EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG
SEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGAS
AASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDGPYSNPYENSLIPAAEPLPPSYVACS
Function
Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate the LYN tyrosine kinase.; Isoform EPOR-T acts as a dominant-negative receptor of EPOR-mediated signaling.
Tissue Specificity
Erythroid cells and erythroid progenitor cells. Isoform EPOR-F is the most abundant form in EPO-dependent erythroleukemia cells and in late-stage erythroid progenitors. Isoform EPOR-S and isoform EPOR-T are the predominant forms in bone marrow. Isoform EPOR-T is the most abundant from in early-stage erythroid progenitor cells.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
Efferocytosis (hsa04148 )
PI3K-Akt sig.ling pathway (hsa04151 )
JAK-STAT sig.ling pathway (hsa04630 )
Hematopoietic cell lineage (hsa04640 )
Pathways in cancer (hsa05200 )
Reactome Pathway
Erythropoietin activates Phosphoinositide-3-kinase (PI3K) (R-HSA-9027276 )
Erythropoietin activates Phospholipase C gamma (PLCG) (R-HSA-9027277 )
Erythropoietin activates STAT5 (R-HSA-9027283 )
Erythropoietin activates RAS (R-HSA-9027284 )
Signaling by Erythropoietin (R-HSA-9006335 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Primary familial polycythemia due to EPO receptor mutation DISFVI97 Strong Autosomal dominant [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
15 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Erythropoietin receptor (EPOR). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Erythropoietin receptor (EPOR). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Erythropoietin receptor (EPOR). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Erythropoietin receptor (EPOR). [5]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Erythropoietin receptor (EPOR). [6]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Erythropoietin receptor (EPOR). [7]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Erythropoietin receptor (EPOR). [8]
Amphotericin B DMTAJQE Approved Amphotericin B increases the expression of Erythropoietin receptor (EPOR). [9]
Gefitinib DM15F0X Approved Gefitinib increases the expression of Erythropoietin receptor (EPOR). [10]
Aluminium DM6ECN9 Approved Aluminium affects the expression of Erythropoietin receptor (EPOR). [11]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Erythropoietin receptor (EPOR). [12]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Erythropoietin receptor (EPOR). [13]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Erythropoietin receptor (EPOR). [15]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Erythropoietin receptor (EPOR). [16]
Nickel chloride DMI12Y8 Investigative Nickel chloride affects the expression of Erythropoietin receptor (EPOR). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Erythropoietin receptor (EPOR). [14]
------------------------------------------------------------------------------------

References

1 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
2 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
3 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
7 In vitro dual effect of arsenic trioxide on hemopoiesis: inhibition of erythropoiesis and stimulation of megakaryocytic maturation. Blood Cells Mol Dis. 2006 Jan-Feb;36(1):59-76. doi: 10.1016/j.bcmd.2005.10.005. Epub 2005 Dec 15.
8 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
9 Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
10 Identification of genes linked to gefitinib treatment in prostate cancer cell lines with or without resistance to androgen: a clue to application of gefitinib to hormone-resistant prostate cancer. Oncol Rep. 2006 Jun;15(6):1453-60.
11 The distinct erythropoietin functions that promote cell survival and proliferation are affected by aluminum exposure through mechanisms involving erythropoietin receptor. Biochim Biophys Acta. 2005 Mar 22;1743(1-2):29-36. doi: 10.1016/j.bbamcr.2004.08.004.
12 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
13 Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
14 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
15 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
16 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
17 Toxicity of nickel ions and comprehensive analysis of nickel ion-associated gene expression profiles in THP-1 cells. Mol Med Rep. 2015 Sep;12(3):3273-3278. doi: 10.3892/mmr.2015.3878. Epub 2015 Jun 3.