Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVESFOA)

DOT Name Coiled-coil-helix-coiled-coil-helix domain-containing protein 5 (CHCHD5)
Gene Name CHCHD5
Related Disease
Advanced cancer ( )
Colon cancer ( )
High blood pressure ( )
Lung cancer ( )
Lung carcinoma ( )
Lung neoplasm ( )
UniProt ID
CHCH5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2LQL
Pfam ID
PF06747 ; PF16860
Sequence
MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQ
PFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS
Reactome Pathway
Mitochondrial protein import (R-HSA-1268020 )

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Colon cancer DISVC52G Strong Biomarker [1]
High blood pressure DISY2OHH Strong Biomarker [2]
Lung cancer DISCM4YA Strong Altered Expression [1]
Lung carcinoma DISTR26C Strong Altered Expression [1]
Lung neoplasm DISVARNB Strong Altered Expression [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Coiled-coil-helix-coiled-coil-helix domain-containing protein 5 (CHCHD5). [3]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Coiled-coil-helix-coiled-coil-helix domain-containing protein 5 (CHCHD5). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Coiled-coil-helix-coiled-coil-helix domain-containing protein 5 (CHCHD5). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Coiled-coil-helix-coiled-coil-helix domain-containing protein 5 (CHCHD5). [6]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Coiled-coil-helix-coiled-coil-helix domain-containing protein 5 (CHCHD5). [7]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Coiled-coil-helix-coiled-coil-helix domain-containing protein 5 (CHCHD5). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 CHTM1 regulates cancer cell sensitivity to metabolic stress via p38-AIF1 pathway.J Exp Clin Cancer Res. 2019 Jun 20;38(1):271. doi: 10.1186/s13046-019-1253-5.
2 A new risk locus in CHCHD5 for hypertension and obesity in a Chinese child population: a cohort study.BMJ Open. 2017 Sep 11;7(9):e016241. doi: 10.1136/bmjopen-2017-016241.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
8 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.