Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW89R8K)

• DOT Name: Lymphocyte antigen 6 complex locus protein G5b (LY6G5B)
• Gene Name: LY6G5B
• Related Disease:
  Epstein barr virus infection
  Rheumatoid arthritis
  Type-1 diabetes
• UniProt ID: LY65B_HUMAN
• Sequence:
  MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITI
  YYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPH
  DRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYL
  FLNSSGLLVLPQAGLLTPHPS

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Epstein barr virus infection	DISOO0WT	Strong	Genetic Variation	[1]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[2]
Type-1 diabetes	DIS7HLUB	Strong	Genetic Variation	[3]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Lymphocyte antigen 6 complex locus protein G5b (LY6G5B).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Lymphocyte antigen 6 complex locus protein G5b (LY6G5B).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Lymphocyte antigen 6 complex locus protein G5b (LY6G5B).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Lymphocyte antigen 6 complex locus protein G5b (LY6G5B).	[7]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Lymphocyte antigen 6 complex locus protein G5b (LY6G5B).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Lymphocyte antigen 6 complex locus protein G5b (LY6G5B).	[9]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Lymphocyte antigen 6 complex locus protein G5b (LY6G5B).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Lymphocyte antigen 6 complex locus protein G5b (LY6G5B).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Lymphocyte antigen 6 complex locus protein G5b (LY6G5B).	[10]

References

• [1] A genome-wide integrative genomic study localizes genetic factors influencing antibodies against Epstein-Barr virus nuclear antigen 1 (EBNA-1).PLoS Genet. 2013;9(1):e1003147. doi: 10.1371/journal.pgen.1003147. Epub 2013 Jan 10.
• [2] A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.Ann Rheum Dis. 2011 Feb;70(2):259-65. doi: 10.1136/ard.2009.126821. Epub 2010 Dec 14.
• [3] A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.Nature. 2007 Aug 2;448(7153):591-4. doi: 10.1038/nature06010. Epub 2007 Jul 15.
• [4] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [5] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [8] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [12] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.