Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWKXOL9)

• DOT Name: Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2)
• Gene Name: C1QTNF2
• UniProt ID: C1QT2_HUMAN
• Pfam ID: PF00386 ; PF01391
• Sequence:
  MIPWVLLACALPCAADPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRM
  GFPGKDGQDGHDGDRGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKH
  GTPGKKGPKGKKGEPGLPGPCSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHY
  NASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILA
  LKQGDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYADQDDPNEV
• Function: Involved in the regulation of lipid metabolism in adipose tissue and liver.
• Tissue Specificity: Expressed in adipose tissue.

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2).	[1]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2).	[2]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2).	[4]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2).	[5]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2).	[6]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [3] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [4] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [5] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [6] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.