Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWPN527)

• DOT Name: Golgi-associated RAB2 interactor protein 1B (GARIN1B)
• Synonyms: Testis development protein NYD-SP18
• Gene Name: GARIN1B
• UniProt ID: GAR1B_HUMAN
• Pfam ID: PF12480
• Sequence:
  MLSSFPHRKTWRKSKKTVKVTRSYPTFPSLNAWEEFRGLLPVDGEPNPGAGLGVEEGLLC
  RVVHSPEFNLFLDSVVFESNFIQVKRGRNWRDVYKASNTMALGVTSSVPCLPLPNILLMA
  SVKWHQGQNQTWNRPSIAPNIFLKRILPLRFVELQVCDHYQRILQLRTVTEKIYYLKLHP
  DHPETVFHFWIRLVQILQKGLSITTKDPRILVTHCLVPKNCSSPSGDSKLVQKKLQASQP
  SESLIQLMTKGESEALSQIFADLHQQNQLSFRSSRKVETNKNSSGKDSSREDSIPCTCDL
  RWRASFTYGEWERENPSGLQPLSLLSTLAASTGPQLAPPIGNSI
• Function: RAB2B effector protein required for accurate acrosome formation and normal male fertility. In complex with RAB2A/RAB2B, seems to suppress excessive vesicle trafficking during acrosome formation.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Golgi-associated RAB2 interactor protein 1B (GARIN1B).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Golgi-associated RAB2 interactor protein 1B (GARIN1B).	[2]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Golgi-associated RAB2 interactor protein 1B (GARIN1B).	[3]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Golgi-associated RAB2 interactor protein 1B (GARIN1B).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Golgi-associated RAB2 interactor protein 1B (GARIN1B).	[2]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Golgi-associated RAB2 interactor protein 1B (GARIN1B).	[5]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Golgi-associated RAB2 interactor protein 1B (GARIN1B).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Golgi-associated RAB2 interactor protein 1B (GARIN1B).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Golgi-associated RAB2 interactor protein 1B (GARIN1B).	[7]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [3] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [4] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [5] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [6] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.