Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXHLK34)

• DOT Name: Uncharacterized protein C1orf50 (C1ORF50)
• Gene Name: C1ORF50
• UniProt ID: CA050_HUMAN
• Pfam ID: PF10504
• Sequence:
  MEDAAAPGRTEGVLERQGAPPAAGQGGALVELTPTPGGLALVSPYHTHRAGDPLDLVALA
  EQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDAHRDANLHHVACNIVKKPGNIY
  YLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLL
  SQSVALPPCTEPNFQGLTH

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Uncharacterized protein C1orf50 (C1ORF50).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Uncharacterized protein C1orf50 (C1ORF50).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Uncharacterized protein C1orf50 (C1ORF50).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Uncharacterized protein C1orf50 (C1ORF50).	[4]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Uncharacterized protein C1orf50 (C1ORF50).	[5]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Uncharacterized protein C1orf50 (C1ORF50).	[6]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Uncharacterized protein C1orf50 (C1ORF50).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Uncharacterized protein C1orf50 (C1ORF50).	[7]

References

• [1] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [5] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [6] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [7] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.