Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY0L6K6)

• DOT Name: Putative GTP-binding protein 6 (GTPBP6)
• Synonyms: Pseudoautosomal GTP-binding protein-like
• Gene Name: GTPBP6
• Related Disease: Parkinson disease
• UniProt ID: GTPB6_HUMAN
• PDB ID: 7OF2; 7OF4; 7OF6
• Pfam ID: PF16360 ; PF13167 ; PF01926
• Sequence:
  MWALRAAVRPGLRLSRVGRGRSAPRAAAPSCPARALAAVGRRSPGNLEGPWGGGRGLRAD
  GGRSRTGDDEEEPEDADENAEEELLRGEPLLPAGTQRVCLVHPDVKWGPGKSQMTRAEWQ
  VAEATALVHTLDGWSVVQTMVVSTKTPDRKLIFGKGNFEHLTEKIRGSPDITCVFLNVER
  MAAPTKKELEAAWGVEVFDRFTVVLHIFRCNARTKEARLQVALAEMPLHRSNLKRDVAHL
  YRGVGSRYIMGSGESFMQLQQRLLREKEAKIRKALDRLRKKRHLLRRQRTRREFPVISVV
  GYTNCGKTTLIKALTGDAAIQPRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHG
  LIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKV
  DLVPGYSPTEPNVVPVSALRGHGLQELKAELDAAVLKATGRQILTLRVRLAGAQLSWLYK
  EATVQEVDVIPEDGAADVRVIISNSAYGKFRKLFPG
• Tissue Specificity: Ubiquitously expressed.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Parkinson disease	DISQVHKL	Strong	Biomarker	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Putative GTP-binding protein 6 (GTPBP6).	[2]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Putative GTP-binding protein 6 (GTPBP6).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Putative GTP-binding protein 6 (GTPBP6).	[4]
Acocantherin	DM7JT24	Approved	Acocantherin increases the expression of Putative GTP-binding protein 6 (GTPBP6).	[5]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Putative GTP-binding protein 6 (GTPBP6).	[6]

References

• [1] Simultaneous Relative Quantification of Various Polyglycerophospholipids with Isotope-Labeled Methylation by Nanoflow Ultrahigh Performance Liquid Chromatography-Tandem Mass Spectrometry.Anal Chem. 2019 May 21;91(10):6716-6723. doi: 10.1021/acs.analchem.9b00800. Epub 2019 Apr 30.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [4] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [5] Ouabain at pathological concentrations might induce damage in human vascular endothelial cells. Acta Pharmacol Sin. 2006 Feb;27(2):165-72. doi: 10.1111/j.1745-7254.2006.00244.x.
• [6] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.