Details of the Drug
General Information of Drug (ID: DMWCQP4)
Drug Name |
Interferon Alfa-2b
|
||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Synonyms | Intron A; Viraferon | ||||||||||||||||||||||
Indication |
|
||||||||||||||||||||||
Therapeutic Class |
Anticancer Agents
|
||||||||||||||||||||||
Drug Type |
Small molecular drug
|
||||||||||||||||||||||
Sequence |
CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVR KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
||||||||||||||||||||||
Structure |
![]() |
||||||||||||||||||||||
3D MOL is unavailable | 2D MOL | ||||||||||||||||||||||
#Ro5 Violations (Lipinski): 1 |
Molecular Weight | 746.5 | |||||||||||||||||||||
Logarithm of the Partition Coefficient | Not Available | ||||||||||||||||||||||
Rotatable Bond Count | 7 | ||||||||||||||||||||||
Hydrogen Bond Donor Count | 0 | ||||||||||||||||||||||
Hydrogen Bond Acceptor Count | 6 | ||||||||||||||||||||||
ADMET Property |
|
||||||||||||||||||||||
Chemical Identifiers |
|
||||||||||||||||||||||
Cross-matching ID | |||||||||||||||||||||||
Combinatorial Drugs (CBD) | Click to Jump to the Detailed CBD Information of This Drug | ||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
![]() Drug Therapeutic Target (DTT) |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Drug Off-Target (DOT) |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas of This Drug
The Studied Disease | Melanoma | |||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
ICD Disease Classification | 2C30 | |||||||||||||||||||||||
|
||||||||||||||||||||||||
Molecular Expression Atlas (MEA) | ||||||||||||||||||||||||
Drug-Drug Interaction (DDI) Information of This Drug
Coadministration of a Drug Treating the Disease Different from Interferon Alfa-2b (Comorbidity)
|
Drug Inactive Ingredient(s) (DIG) and Formulation(s) of This Drug
References
1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
---|---|---|---|---|---|
2 | Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds | ||||
3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | ||||
4 | 6-Hydroxy-3-O-methyl-kaempferol 6-O-glucopyranoside potentiates the anti-proliferative effect of interferon / by promoting activation of the JAK/STAT signaling by inhibiting SOCS3 in hepatocellular carcinoma cells. Toxicol Appl Pharmacol. 2017 Dec 1;336:31-39. doi: 10.1016/j.taap.2017.10.004. Epub 2017 Oct 12. | ||||
5 | Cerner Multum, Inc. "Australian Product Information.". | ||||
6 | Product Information. Aubagio (teriflunomide). Genzyme Corporation, Cambridge, MA. | ||||
7 | Product Information. Sirturo (bedaquiline). Janssen Pharmaceuticals, Titusville, NJ. | ||||
8 | Cerner Multum, Inc. "UK Summary of Product Characteristics.". | ||||
9 | Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ. | ||||
10 | Product Information. Accolate (zafirlukast). Zeneca Pharmaceuticals, Wilmington, DE. | ||||
11 | Elsharkawy AM, Schwab U, McCarron B, et al. "Efavirenz induced acute liver failure requiring liver transplantation in a slow drug metaboliser." J Clin Virol 58 (2013): 331-3. [PMID: 23763943] | ||||
12 | Argov Z, Mastaglia FL "Drug-induced peripheral neuropathies." Br Med J 1 (1979): 663-6. [PMID: 219931] | ||||
13 | Product Information. Kynamro (mipomersen). Genzyme Corporation, Cambridge, MA. | ||||
14 | Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO. | ||||
15 | Product Information. Juxtapid (lomitapide). Aegerion Pharmaceuticals Inc, Cambridge, MA. | ||||
16 | Product Information. Rozerem (ramelteon). Takeda Pharmaceuticals America, Lincolnshire, IL. | ||||
17 | Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA. | ||||
18 | Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA. | ||||
19 | Al-Nawakil C, Willems L, Mauprivez C, et.al "Successful treatment of l-asparaginase-induced severe acute hepatotoxicity using mitochondrial cofactors." Leuk Lymphoma 55 (2014): 1670-4. [PMID: 24090500] | ||||
20 | Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA. | ||||
21 | Product Information. Clolar (clofarabine). sanofi-aventis, Bridgewater, NJ. | ||||
22 | Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA. | ||||
23 | Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ. | ||||
24 | Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA. | ||||
25 | Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA. | ||||
26 | Product Information. Wellbutrin XL (buPROPion). GlaxoSmithKline, Philadelphia, PA. | ||||
27 | Product Information. Ultram (tramadol). McNeil Pharmaceutical, Raritan, NJ. | ||||
28 | Product Information. Noroxin (norfloxacin). Merck & Co, Inc, West Point, PA. | ||||
29 | Matsuoka LY "Convulsions following application of gamma benzene hexachloride." J Am Acad Dermatol 5 (1981): 98-9. [PMID: 6168673] | ||||
30 | Product Information. ReVia (naltrexone). DuPont Pharmaceuticals, Wilmington, DE. | ||||
31 | Granfors MT, Backman JT, Laitila J, Neuvonen PJ "Tizanidine is mainly metabolized by cytochrome P450 1A2 in vitro." Br J Clin Pharmacol 57 (2004): 349-53. [PMID: 14998432] | ||||