Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTQ3ZHF)

• DTP Name: Multidrug resistance-associated protein 3 (ABCC3)
• Gene Name: ABCC3
• UniProt ID: O15438 (MRP3_HUMAN)
• VARIDT ID: DTD0012
• Synonyms: ABC31; ABCC3; ATP-binding cassette sub-family C member 3; CMOAT2; Canalicular multispecific organic anion transporter 2; EST90757; MLP2; MOAT-D; MRP3; Multi-specific organic anion transporter D
• DTP Family:
  ATP-Binding Cassette (ABC) Superfamily
  Drug Conjugate Transporter (DCT) Family (ABCC)
• Tissue Specificity: Mainly expressed in the liver. Also expressedin small intestine, colon, prostate, testis, brain and at a lowerlevel in the kidney.
• Sequence:
  MDALCGSGELGSKFWDSNLSVHTENPDLTPCFQNSLLAWVPCIYLWVALPCYLLYLRHHC
  RGYIILSHLSKLKMVLGVLLWCVSWADLFYSFHGLVHGRAPAPVFFVTPLVVGVTMLLAT
  LLIQYERLQGVQSSGVLIIFWFLCVVCAIVPFRSKILLAKAEGEISDPFRFTTFYIHFAL
  VLSALILACFREKPPFFSAKNVDPNPYPETSAGFLSRLFFWWFTKMAIYGYRHPLEEKDL
  WSLKEEDRSQMVVQQLLEAWRKQEKQTARHKASAAPGKNASGEDEVLLGARPRPRKPSFL
  KALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGFLVAGLMFLCS
  MMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRF
  MDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQ
  MKLKDSRIKLMSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQLLRTAAYLHTTTTFTWM
  CSPFLVTLITLWVYVYVDPNNVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLK
  RIQQFLSQEELDPQSVERKTISPGYAITIHSGTFTWAQDLPPTLHSLDIQVPKGALVAVV
  GPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRY
  QQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDADIFLLDDPLSA
  VDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQVSEMGPYPALLQ
  RNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQ
  KQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW
  DYAKAVGLCTTLAICLLYVGQSAAAIGANVWLSAWTNDAMADSRQNNTSLRLGVYAALGI
  LQGFLVMLAAMAMAAGGIQAARVLHQALLHNKIRSPQSFFDTTPSGRILNCFSKDIYVVD
  EVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAVLYTLVQRFYAATSRQLKRLE
  SVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYIISNRWLSIGVE
  FVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERV
  KEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVG
  IVGRTGAGKSSMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTL
  RMNLDPFGSYSEEDIWWALELSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARAL
  LRKSRILVLDEATAAIDLETDNLIQATIRTQFDTCTVLTIAHRLNTIMDYTRVLVLDKGV
  VAEFDSPANLIAARGIFYGMARDAGLA
• Function: This transporter may act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes.
• Endogenous Substrate(s): Canicular organoanions; GSH-X; Sulfate-X; Bile acids; Bilirubin-glucuronides; Epoposide glucuronide; Estradiol 17-beta-D-glucuronide; Glycocholate; Leukotriene C4
• TCDB ID: 3.A.1.208.9
• Gene ID: 8714
• KEGG Pathway:
  Antifolate resistance (hsa01523)
  ABC transporters (hsa02010)
  Bile secretion (hsa04976)
• Reactome Pathway:
  ABC-family proteins mediated transport (R-HSA-382556)
  Aspirin ADME (R-HSA-9749641)
  Paracetamol ADME (R-HSA-9753281)
  Recycling of bile acids and salts (R-HSA-159418)

Molecular Interaction Atlas (MIA) of This DTP

16 Approved Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Cefadroxil	DMMC345	Bacterial infection	1A00-1C4Z	Approved	[1]
Dehydroepiandrosterone sulfate	DM4Q80H	N. A.	N. A.	Approved	[2]
Efavirenz	DMC0GSJ	Human immunodeficiency virus infection	1C62	Approved	[3]
Etoposide	DMNH3PG	Acute myelogenous leukaemia	2A41	Approved	[4]
Etravirine	DMGV8QU	Human immunodeficiency virus-1 infection	1C62	Approved	[5]
Ezetimibe	DM7A8TW	Atherosclerosis	BD40	Approved	[6]
Fexofenadine	DM17ONX	Allergic rhinitis	CA08.0	Approved	[7]
Fluorouracil	DMUM7HZ	Adenocarcinoma	2D40	Approved	[8]
Folic Acid	DMEMBJC	Colorectal carcinoma		Approved	[9]
Glibenclamide	DM8JXPZ	Diabetic complication	5A2Y	Approved	[10]
Leucovorin	DMUAZWG	Colon adenocarcinoma		Approved	[9]
Methotrexate	DM2TEOL	Anterior urethra cancer		Approved	[11]
Morphine	DMRMS0L	Advanced cancer	2A00-2F9Z	Approved	[12]
Paclitaxel	DMLB81S	Breast carcinoma		Approved	[13]
Technetium (99MTC) mebrofenin	DMUEWM3	N. A.	N. A.	Approved	[14]
Teniposide	DMLW57T	Acute lymphoblastic leukaemia	2A85	Approved	[15]

5 Clinical Trial Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GLYCYRRHIZIN	DM8M2N3	Influenza virus infection	1E30-1E32	Phase 3	[16]
Cholyl lysyl fluorescein	DMALN2M	N. A.	N. A.	Phase 2	[17]
Glutathione-S-S-glutathione	DMJ85FS	N. A.	N. A.	Phase 2	[18]
Sodium taurocholate	DM3GO0J	Type-2 diabetes	5A11	Phase 1/2	[19]
Taurocholic Acid	DM2LZ8F	Type-2 diabetes	5A11	Phase 1/2	[19]

3 Preclinical Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Epipodophyllotoxins	DMVNR20	N. A.	N. A.	Preclinical	[15]
Monomethyl-auristatin-E	DMG2UJS	N. A.	N. A.	Preclinical	[13]
Scutellarin	DMJT1E5	N. A.	N. A.	Preclinical	[20]

2 Investigative Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
glycocholic acid	DM0SXNM	Discovery agent	N.A.	Investigative	[21]
[3H]estradiol-17beta-glucuronide	DM3KJ45	Discovery agent	N.A.	Investigative	[19]

Molecular Expression Atlas (MEA) of This DTP

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	1.26E-04	-1.13E-01	-4.58E-01
Adrenocortical carcinoma	2D11.Z	Kidney	6.82E-02	-3.29E-01	-3.24E-01
Alopecia	ED70	Skin from scalp	4.64E-02	2.17E-01	7.39E-01
Alzheimer's disease	8A20	Entorhinal cortex	6.31E-01	-3.57E-02	-2.48E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	9.91E-01	-7.27E-03	-2.51E-02
Aortic stenosis	BB70	Calcified aortic valve	1.10E-01	3.13E-01	1.73E+00
Apnea	7A40	Hyperplastic tonsil	1.43E-01	2.95E-01	7.80E-01
Arthropathy	FA00-FA5Z	Peripheral blood	2.35E-02	1.64E-01	7.13E-01
Asthma	CA23	Nasal and bronchial airway	1.42E-01	7.71E-02	1.55E-01
Atopic dermatitis	EA80	Skin	3.35E-03	-1.78E-01	-7.11E-01
Autism	6A02	Whole blood	2.07E-01	8.26E-02	4.14E-01
Autoimmune uveitis	9A96	Peripheral monocyte	8.17E-01	1.68E-01	4.83E-01
Autosomal dominant monocytopenia	4B04	Whole blood	9.97E-01	7.14E-02	3.08E-01
Bacterial infection of gingival	1C1H	Gingival tissue	4.25E-08	2.39E-01	8.82E-01
Batten disease	5C56.1	Whole blood	9.74E-01	1.29E-01	3.40E-01
Behcet's disease	4A62	Peripheral blood	2.22E-01	2.67E-01	7.79E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	1.09E-02	-1.24E-01	-8.09E-01
Bladder cancer	2C94	Bladder tissue	4.80E-01	-1.64E-01	-5.49E-01
Breast cancer	2C60-2C6Z	Breast tissue	8.66E-15	1.38E-01	3.37E-01
Cardioembolic stroke	8B11.20	Whole blood	3.22E-02	-1.91E-01	-7.65E-01
Cervical cancer	2C77	Cervical tissue	8.32E-01	2.31E-03	5.67E-03
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	1.47E-01	1.91E-01	6.05E-01
Chronic hepatitis C	1E51.1	Whole blood	6.61E-01	2.65E-02	2.32E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	8.79E-01	9.24E-02	2.14E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	1.60E-01	1.62E-01	3.86E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	4.69E-02	1.93E-01	2.75E+00
Colon cancer	2B90	Colon tissue	1.33E-23	-5.62E-01	-1.05E+00
Coronary artery disease	BA80-BA8Z	Peripheral blood	9.61E-01	2.71E-01	5.02E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	6.15E-01	-2.72E-03	-1.63E-02
Endometriosis	GA10	Endometrium tissue	3.46E-03	6.23E-01	1.15E+00
Familial hypercholesterolemia	5C80.00	Peripheral blood	3.17E-01	-8.64E-02	-3.80E-01
Familial hypercholesterolemia	5C80.00	Whole blood	5.09E-05	4.90E-01	1.66E+00
Gastric cancer	2B72	Gastric tissue	2.70E-01	-1.37E+00	-1.26E+00
Glioblastopma	2A00.00	Nervous tissue	5.88E-86	2.56E-01	1.33E+00
Glioma	2A00.0Y-2A00.0Z	White matter tissue	9.47E-01	1.55E-02	6.23E-02
Head and neck cancer	2D42	Head and neck tissue	7.51E-03	-2.03E-01	-6.16E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	3.42E-01	-4.73E-02	-3.72E-01
Huntington's disease	8A01.10	Whole blood	8.96E-02	2.20E-01	9.58E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	1.15E-06	1.09E+00	5.58E+00
Immunodeficiency	4A00-4A20	Peripheral blood	7.00E-01	3.29E-02	5.10E-01
Influenza	1.00E+30	Whole blood	9.01E-01	5.78E-02	1.79E-01
Interstitial cystitis	GC00.3	Bladder tissue	1.02E-03	-1.29E+00	-3.11E+00
Intracranial aneurysm	8B01.0	Intracranial artery	2.69E-03	4.96E-01	2.26E+00
Irritable bowel syndrome	DD91.0	Rectal colon tissue	2.59E-01	-8.92E-02	-2.02E-01
Ischemic stroke	8B11	Peripheral blood	4.03E-01	-1.03E-01	-3.12E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	2.54E-01	4.75E-03	1.95E-02
Lateral sclerosis	8B60.4	Cervical spinal cord	1.53E-01	1.56E-01	5.48E-01
Lateral sclerosis	8B60.4	Skin	7.97E-01	3.67E-02	1.29E-01
Liver cancer	2C12.0	Liver tissue	4.85E-02	-7.33E-02	-1.70E-01
Liver failure	DB99.7-DB99.8	Liver tissue	3.21E-02	-7.44E-01	-1.48E+00
Lung cancer	2C25	Lung tissue	2.33E-64	7.64E-01	2.24E+00
Lupus erythematosus	4A40	Whole blood	3.43E-01	-4.32E-02	-1.22E-01
Major depressive disorder	6A70-6A7Z	Whole blood	5.59E-01	1.04E-01	3.55E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	8.71E-01	1.90E-02	1.26E-01
Melanoma	2C30	Skin	1.15E-03	-6.21E-01	-7.80E-01
Multiple myeloma	2A83.1	Bone marrow	2.52E-01	4.16E-02	1.94E-01
Multiple myeloma	2A83.1	Peripheral blood	7.88E-01	2.82E-02	1.45E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	2.14E-01	3.38E-01	1.00E+00
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	5.49E-02	6.11E-02	2.00E-01
Myelofibrosis	2A20.2	Whole blood	1.04E-01	2.08E-01	1.42E+00
Myocardial infarction	BA41-BA50	Peripheral blood	2.85E-02	6.78E-01	8.24E-01
Myopathy	8C70.6	Muscle tissue	6.10E-01	-2.47E-02	-1.65E-01
Neonatal sepsis	KA60	Whole blood	1.46E-06	1.48E-01	6.49E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	1.55E-03	-4.44E-01	-1.83E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	7.15E-01	1.02E-01	4.34E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	2.19E-02	2.26E-01	1.80E+00
Olive pollen allergy	CA08.00	Peripheral blood	5.80E-01	4.05E-01	5.79E-01
Oral cancer	2B6E	Oral tissue	8.85E-01	3.14E-02	1.00E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	2.46E-01	3.98E-01	8.07E-01
Osteoporosis	FB83.1	Bone marrow	2.29E-02	8.31E-01	2.03E+00
Ovarian cancer	2C73	Ovarian tissue	3.48E-03	2.99E-01	1.12E+00
Pancreatic cancer	2C10	Pancreas	4.92E-04	1.06E+00	1.51E+00
Parkinson's disease	8A00.0	Substantia nigra tissue	9.17E-01	-6.21E-03	-3.18E-02
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	3.58E-01	5.60E-02	5.29E-01
Pituitary cancer	2D12	Pituitary tissue	2.48E-01	8.14E-03	4.05E-02
Pituitary gonadotrope tumour	2D12	Pituitary tissue	1.66E-01	4.95E-02	2.39E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	3.28E-01	-8.33E-02	-4.43E-01
Polycythemia vera	2A20.4	Whole blood	3.36E-02	-1.03E-01	-6.81E-01
Pompe disease	5C51.3	Biceps muscle	5.68E-01	-6.36E-02	-3.11E-01
Preterm birth	KA21.4Z	Myometrium	3.76E-01	-4.47E-02	-1.28E-01
Prostate cancer	2C82	Prostate	8.30E-05	-1.13E+00	-1.30E+00
Psoriasis	EA90	Skin	3.13E-09	-3.10E-01	-1.05E+00
Rectal cancer	2B92	Rectal colon tissue	3.88E-01	-1.09E-01	-4.21E-01
Renal cancer	2C90-2C91	Kidney	7.01E-05	6.87E-01	1.87E+00
Retinoblastoma	2D02.2	Uvea	6.32E-01	-1.17E-01	-4.76E-01
Rheumatoid arthritis	FA20	Synovial tissue	6.81E-01	1.48E-01	4.39E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	2.52E-01	-2.84E-02	-1.43E-01
Schizophrenia	6A20	Prefrontal cortex	2.10E-02	7.69E-02	2.21E-01
Schizophrenia	6A20	Superior temporal cortex	2.00E-01	-6.94E-02	-5.65E-01
Scleroderma	4A42.Z	Whole blood	3.40E-01	4.08E-02	1.98E-01
Seizure	8A60-8A6Z	Whole blood	6.59E-02	-2.01E-01	-6.82E-01
Sensitive skin	EK0Z	Skin	1.17E-01	1.50E-01	5.44E-01
Sepsis with septic shock	1G41	Whole blood	8.33E-01	-2.37E-02	-1.20E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	1.31E-01	2.74E-01	1.01E+00
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	1.58E-01	1.35E-01	3.67E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	6.50E-01	-3.81E-02	-1.49E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	3.82E-01	-3.55E-02	-6.18E-01
Skin cancer	2C30-2C3Z	Skin	1.89E-70	-8.20E-01	-1.90E+00
Thrombocythemia	3B63	Whole blood	3.37E-01	-1.41E-02	-8.96E-02
Thrombocytopenia	3B64	Whole blood	2.88E-01	3.62E-01	6.78E-01
Thyroid cancer	2D10	Thyroid	3.61E-56	1.02E+00	3.07E+00
Tibial muscular dystrophy	8C75	Muscle tissue	2.29E-02	-2.25E-01	-1.21E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	5.10E-02	4.99E-01	6.35E+00
Type 2 diabetes	5A11	Liver tissue	9.87E-01	-1.86E-01	-4.71E-01
Ureter cancer	2C92	Urothelium	1.27E-01	2.19E-02	1.19E-01
Uterine cancer	2C78	Endometrium tissue	6.52E-01	8.39E-02	1.21E-01
Vitiligo	ED63.0	Skin	1.16E-03	1.72E-01	1.84E+00

Drug Affinity of This DTP Assessed by Cell Line

Approved Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Cefadroxil	Approved	Spodoptera frugiperda 21 (Sf21) cells-MRP3	Km = 2.5 microM	[1]
Etoposide	Approved	Spodoptera frugiperda (Sf9) cells-MRP3	Km = 11.4 microM	[15]
Folic Acid	Approved	Human embryonic kidney cells (HEK293)-MRP3	Km = 1960.0 microM	[9]
Methotrexate	Approved	Breast carcinoma cell line (MCF7)-MRP3	Km = 910.0 microM	[11]
Methotrexate	Approved	Human embryonic kidney cells (HEK293)-MRP3	Km = 620.0 microM	[9]
Methotrexate	Approved	Human embryonic kidney cells (HEK293)-MRP3	Km = 776.0 microM	[22]

Clinical Trial Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Sodium taurocholate	Phase 1/2	Human embryonic kidney cells (HEK293)-MRP3	Km = 30.0 microM	[19]

Investigative Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
[3H]estradiol-17beta-glucuronide	Investigative	Human embryonic kidney cells (HEK293)-MRP3	Km = 25.6 microM	[22]
[3H]estradiol-17beta-glucuronide	Investigative	Human embryonic kidney cells (HEK293)-MRP3	Km = 29.0 microM	[19]
[3H]estradiol-17beta-glucuronide	Investigative	Spodoptera frugiperda (Sf9) cells-MRP3	Km = 17.7 microM	[15]

The Drug Therapeutic Target (DTT) Role of This DTP

• DTP DTT Name: Multidrug resistance protein 3 DTT Info

References

• [1] Oral availability of cefadroxil depends on ABCC3 and ABCC4. Drug Metab Dispos. 2012 Mar;40(3):515-21.
• [2] Integration of hepatic drug transporters and phase II metabolizing enzymes: mechanisms of hepatic excretion of sulfate, glucuronide, and glutathione metabolites. Eur J Pharm Sci. 2006 Apr;27(5):447-86.
• [3] Induction of multiple drug transporters by efavirenz. J Pharmacol Sci. 2009 Feb;109(2):242-50.
• [4] Functional reconstitution of human ABCC3 into proteoliposomes reveals a transport mechanism with positive cooperativity. Biochemistry. 2009 May 26;48(20):4423-30.
• [5] Interaction potential of etravirine with drug transporters assessed in vitro. Antimicrob Agents Chemother. 2011 Mar;55(3):1282-4.
• [6] Complex pharmacokinetic behavior of ezetimibe depends on abcc2, abcc3, and abcg2. Drug Metab Dispos. 2009 Aug;37(8):1698-702.
• [7] Involvement of multiple efflux transporters in hepatic disposition of fexofenadine. Mol Pharmacol. 2008 May;73(5):1474-83.
• [8] ATP-binding cassette C transporters in human pancreatic carcinoma cell lines. Upregulation in 5-fluorouracil-resistant cells. Pancreatology. 2009;9(1-2):136-44.
• [9] Transport of methotrexate (MTX) and folates by multidrug resistance protein (MRP) 3 and MRP1: effect of polyglutamylation on MTX transport. Cancer Res. 2001 Oct 1;61(19):7225-32.
• [10] Transport of glyburide by placental ABC transporters: implications in fetal drug exposure. Placenta. 2006 Nov-Dec;27(11-12):1096-102.
• [11] Multidrug resistance protein (MRP) 1 and MRP3 attenuate cytotoxic and transactivating effects of the cyclopentenone prostaglandin, 15-deoxy-Delta(12,14)prostaglandin J2 in MCF7 breast cancer cells. Biochemistry. 2003 May 13;42(18):5429-37.
• [12] Multidrug resistance-associated proteins 3, 4, and 5. Pflugers Arch. 2007 Feb;453(5):661-73.
• [13] Functional genomics identifies ABCC3 as a mediator of taxane resistance in HER2-amplified breast cancer. Cancer Res. 2008 Jul 1;68(13):5380-9.
• [14] Mammalian drug efflux transporters of the ATP binding cassette (ABC) family in multidrug resistance: A review of the past decade. Cancer Lett. 2016 Jan 1;370(1):153-64.
• [15] Characterization of drug transport by the human multidrug resistance protein 3 (ABCC3). J Biol Chem. 2001 Dec 7;276(49):46400-7.
• [16] The combination of glycyrrhizin and lamivudine can reverse the cisplatin resistance in hepatocellular carcinoma cells through inhibition of multidrug resistance-associated proteins. Int J Oncol. 2007 Dec;31(6):1465-72.
• [17] The emerging role of transport systems in liver function tests. Eur J Pharmacol. 2012 Jan 30;675(1-3):1-5.
• [18] MRP2 and 3 in health and disease. Cancer Lett. 2006 Mar 8;234(1):51-61.
• [19] Characterization of the role of polar amino acid residues within predicted transmembrane helix 17 in determining the substrate specificity of multidrug resistance protein 3. Biochemistry. 2003 Aug 26;42(33):9989-10000.
• [20] Mechanistic studies on the absorption and disposition of scutellarin in humans: selective OATP2B1-mediated hepatic uptake is a likely key determinant for its unique pharmacokinetic characteristics. Drug Metab Dispos. 2012 Oct;40(10):2009-20.
• [21] Measurement of transport activities of bile acids in human multidrug resistance-associated protein 3 using liquid chromatography-tandem mass spectrometry. Anal Sci. 2010;26(3):317-23.
• [22] Transport of amphipathic anions by human multidrug resistance protein 3. Cancer Res. 2000 Sep 1;60(17):4779-84.