Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T74312
|
||||
| Former ID |
TTDS00090
|
||||
| Target Name |
FL cytokine receptor
|
||||
| Gene Name |
FLT3
|
||||
| Synonyms |
CD135 antigen; FLT3 tyrosine kinase ; Receptor tyrosine kinase FLT3; STK-1; Stem cell tyrosine kinase 1; Tyrosine-protein kinase receptor FLT3; FLT3
|
||||
| Target Type |
Successful
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Acute myeloid leukemia; Prostate cancer; Pancreatic cancer [ICD9: 140-199, 140-229, 157, 205.0, 210-229; ICD10: C25, C92.0, D10-D36, D3A] | |||||
| Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0] | |||||
| Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | |||||
| Airway inflammation [ICD9: 460-519; ICD10: J00-J99] | |||||
| Breast cancer; Colorectal cancer [ICD9: 153, 154, 174, 175; ICD10: C18-C21, C50] | |||||
| Chronic pain [ICD9: 338.2,780; ICD10: R52.1-R52.2, G89] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Cancer; Hematopoietic stem cell transplantation [ICD9:140-229; ICD10: C00-C96, Z00-Z99] | |||||
| Colon cancer; Breast cancer; CLL; AML; GIST [ICD9: 140-199, 150-159, 200, 202, 202.8, 204.1, 205.0, 210-229; ICD10: C00-C75, C15-C26, C7A, C7B, C81-C86, C82-C85, C91.1, C92.0, D10-D36, D3A] | |||||
| Glioblatoma; Gliosarcoma; Anaplastic mixed oligoastrocytoma [ICD9: 191; ICD10: C71] | |||||
| Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Myelofibrosis [ICD9: 208.9, 289.83, 709.2; ICD10: C94.4, D47.4] | |||||
| Myeloid leukemia [ICD9: 208.9; ICD10: C92] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine FLT3LG and regulates differentiation, proliferation and survival of hematopoietic progenitor cells and of dendritic cells. Promotes phosphorylation of SHC1 and AKT1, and activation of the downstream effector MTOR. Promotes activation of RAS signaling and phosphorylation of downstream kinases, including MAPK1/ERK2 and/or MAPK3/ERK1. Promotes phosphorylation of FES, FER, PTPN6/SHP, PTPN11/SHP-2, PLCG1, and STAT5A and/or STAT5B. Activation of wild-type FLT3 causes only marginal activation of STAT5A or STAT5B. Mutations that cause constitutive kinase activity promote cell proliferation and resistance to apoptosis via the activation of multiple signaling pathways.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T74312
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.10.1
|
||||
| Sequence |
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS |
||||
| Structure |
1RJB; 3QS7; 3QS9
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Midostaurin | Drug Info | Approved | Acute myeloid leukemia | [889446] |
| Ponatinib | Drug Info | Approved | Acute lymphoblastic leukemia | [532210], [541188] | |
| Lestaurtinib | Drug Info | Approved (orphan drug) | Acute myeloid leukemia | [537117], [541016] | |
| Lestaurtinib | Drug Info | Phase 3 | Myeloid leukemia | [537117], [541016] | |
| Pacritinib | Drug Info | Phase 3 | Myelofibrosis | [524636], [542744], [550572] | |
| PLX-3397 | Drug Info | Phase 3 | Alzheimer disease | [525099] | |
| Lestaurtinib | Drug Info | Phase 2/3 | Psoriasis | [528330], [529136], [541016] | |
| BMS-690514 | Drug Info | Phase 2 | Chronic pain | [528940] | |
| CDX-301 | Drug Info | Phase 2 | Cancer; Hematopoietic stem cell transplantation | [524740] | |
| Famitinib | Drug Info | Phase 2 | Cancer | [532104], [542811] | |
| Lestaurtinib | Drug Info | Phase 2 | Acute myeloid leukemia; Prostate cancer; Pancreatic cancer | [537117], [541016] | |
| Midostaurin | Drug Info | Phase 2 | Colon cancer; Breast cancer; CLL; AML; GIST | [537114], [541045] | |
| MK-2461 | Drug Info | Phase 1/2 | Alzheimer disease | [530708] | |
| 4SC-203 | Drug Info | Phase 1 | Solid tumours | [551497] | |
| IMC-EB10 | Drug Info | Phase 1 | Acute myeloid leukemia | [522646] | |
| Ki23819 | Drug Info | Phase 1 | Cancer | [527373] | |
| KW-2449 | Drug Info | Phase 1 | Acute myeloid leukemia | [530222], [541033] | |
| Midostaurin | Drug Info | Phase 1 | Breast cancer; Colorectal cancer | [537114], [541045] | |
| MC-2001 | Drug Info | Preclinical | Leukemia | [548002] | |
| Tandutinib | Drug Info | Discontinued in Phase 2 | Glioblatoma; Gliosarcoma; Anaplastic mixed oligoastrocytoma | [541036], [547540] | |
| AG1295 | Drug Info | Terminated | Discovery agent | [541205], [546396] | |
| SU5614 | Drug Info | Terminated | Airway inflammation | [547279] | |
| Inhibitor | (1H-indol-2-yl)(5-methoxy-1H-indol-2-yl)methanone | Drug Info | [528209] | ||
| (1H-indol-2-yl)(5-phenoxy-1H-indol-2-yl)methanone | Drug Info | [528209] | |||
| (1H-indol-2-yl)(6-methoxy-1H-indol-2-yl)methanone | Drug Info | [528209] | |||
| (5-fluoro-1H-indol-2-yl)-(1H-indol-2-yl)methanone | Drug Info | [528209] | |||
| (5-hydroxy-1H-indol-2-yl)(1H-indol-2-yl)methanone | Drug Info | [528209] | |||
| (benzo[b]furan-2-yl)-(1H-indol-2-yl)methanone | Drug Info | [528608] | |||
| 2-(3,4-dimethoxybenzamido)thiophene-3-carboxamide | Drug Info | [528114] | |||
| 4-(4-aminophenyl)-1H-indazol-3yl-amine | Drug Info | [528716] | |||
| AG1295 | Drug Info | [528608] | |||
| AKN-028 | Drug Info | [543494] | |||
| AST-487 | Drug Info | [531679] | |||
| Bis(5-acetoxybenzo[b]furan-2-yl)methanone | Drug Info | [528608] | |||
| Bis(5-aminobenzo[b]furan-2-yl)methanone | Drug Info | [528608] | |||
| Bis(5-hydroxybenzo[b]furan-2-yl)methanone | Drug Info | [528608] | |||
| Bis(6-hydroxybenzo[b]furan-2-yl)methanone | Drug Info | [528608] | |||
| Bis(benzo[b]furan-2-yl)methanone | Drug Info | [528608] | |||
| Bis-(5-hydroxy-1H-indol-2-yl)-methanone | Drug Info | [528209] | |||
| BMS-690514 | Drug Info | [530732] | |||
| CDX-301 | Drug Info | [533222] | |||
| compound 14k | Drug Info | [531649] | |||
| compound 2c | Drug Info | [532818] | |||
| compound 8h | Drug Info | [531959] | |||
| Di(1H-indol-2-yl)methanone | Drug Info | [528209] | |||
| Famitinib | Drug Info | [532104] | |||
| Flt-3 inhibitor II | Drug Info | [528209] | |||
| G749 | Drug Info | [532674] | |||
| GTP-14564 | Drug Info | [526648] | |||
| IN1479 | Drug Info | [528317] | |||
| JNJ-28312141 | Drug Info | [530495] | |||
| Ki23819 | Drug Info | [536065] | |||
| MC-2001 | Drug Info | [526836] | |||
| Midostaurin | Drug Info | [536474], [537142] | |||
| MK-2461 | Drug Info | [530708] | |||
| N-[4-(3-amino-1H-indazol-4-yl)phenyl]benzamide | Drug Info | [528716] | |||
| PLX-3397 | Drug Info | [550447] | |||
| SU5614 | Drug Info | [537173] | |||
| Tandutinib | Drug Info | [536474], [551717] | |||
| TCS-359 | Drug Info | [528114] | |||
| URMC-099 | Drug Info | [532479] | |||
| Modulator | 4SC-203 | Drug Info | [1572591] | ||
| Lestaurtinib | Drug Info | [528330], [529136] | |||
| Pacritinib | Drug Info | [543494] | |||
| Ponatinib | Drug Info | [551871] | |||
| Binder | Dendrigen | Drug Info | [543494] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| Pathways | |||||
| References | |||||
| Ref 522646 | ClinicalTrials.gov (NCT00887926) Study of EB10 in Patients With Leukemia. U.S. National Institutes of Health. | ||||
| Ref 524636 | ClinicalTrials.gov (NCT02055781) Oral Pacritinib Versus Best Available Therapy to Treat Myelofibrosis With Thrombocytopenia. U.S. National Institutes of Health. | ||||
| Ref 524740 | ClinicalTrials.gov (NCT02129075) CDX-1401 and Poly-ICLC Vaccine Therapy With or Without CDX-301in Treating Patients With Stage IIB-IV Melanoma. U.S. National Institutes of Health. | ||||
| Ref 525099 | ClinicalTrials.gov (NCT02371369) PLX3397 Phase 3 Study for Pigmented Villonodular Synovitis (PVNS) or Giant Cell Tumor of the Tendon Sheath (GCT-TS). U.S. National Institutes of Health. | ||||
| Ref 527373 | Mol Cancer Ther. 2004 Dec;3(12):1639-49.KRN633: A selective inhibitor of vascular endothelial growth factor receptor-2 tyrosine kinase that suppresses tumor angiogenesis and growth. | ||||
| Ref 528330 | A phase 2 trial of the FLT3 inhibitor lestaurtinib (CEP701) as first-line treatment for older patients with acute myeloid leukemia not considered fit for intensive chemotherapy. Blood. 2006 Nov 15;108(10):3262-70. Epub 2006 Jul 20. | ||||
| Ref 528940 | A novel epidermal growth factor receptor inhibitor promotes apoptosis in non-small cell lung cancer cells resistant to erlotinib. Cancer Res. 2007 Jul 1;67(13):6253-62. | ||||
| Ref 529136 | Lestaurtinib (CEP701) is a JAK2 inhibitor that suppresses JAK2/STAT5 signaling and the proliferation of primary erythroid cells from patients with myeloproliferative disorders. Blood. 2008 Jun 15;111(12):5663-71. Epub 2007 Nov 5. | ||||
| Ref 530222 | KW-2449, a novel multikinase inhibitor, suppresses the growth of leukemia cells with FLT3 mutations or T315I-mutated BCR/ABL translocation. Blood. 2009 Aug 20;114(8):1607-17. | ||||
| Ref 530708 | MK-2461, a novel multitargeted kinase inhibitor, preferentially inhibits the activated c-Met receptor. Cancer Res. 2010 Feb 15;70(4):1524-33. | ||||
| Ref 532104 | Metabolism and bioactivation of famitinib, a novel inhibitor of receptor tyrosine kinase, in cancer patients. Br J Pharmacol. 2013 Apr;168(7):1687-706. | ||||
| Ref 541016 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5672). | ||||
| Ref 541033 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5691). | ||||
| Ref 541036 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5695). | ||||
| Ref 541045 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5702). | ||||
| Ref 541188 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5890). | ||||
| Ref 541205 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5914). | ||||
| Ref 542744 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7793). | ||||
| Ref 542811 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7886). | ||||
| Ref 546396 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007894) | ||||
| Ref 547279 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014776) | ||||
| Ref 547540 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017148) | ||||
| Ref 526648 | Selective cytotoxic mechanism of GTP-14564, a novel tyrosine kinase inhibitor in leukemia cells expressing a constitutively active Fms-like tyrosine kinase 3 (FLT3). J Biol Chem. 2003 Aug 29;278(35):32892-8. Epub 2003 Jun 18. | ||||
| Ref 526836 | Vascular endothelial growth factor and its receptors in multiple myeloma. Leukemia. 2003 Oct;17(10):1961-6. | ||||
| Ref 528114 | Bioorg Med Chem Lett. 2006 Jun 15;16(12):3282-6. Epub 2006 Mar 31.Identification of 2-acylaminothiophene-3-carboxamides as potent inhibitors of FLT3. | ||||
| Ref 528177 | IMC-EB10, an anti-FLT3 monoclonal antibody, prolongs survival and reduces nonobese diabetic/severe combined immunodeficient engraftment of some acute lymphoblastic leukemia cell lines and primary leukemic samples. Cancer Res. 2006 May 1;66(9):4843-51. | ||||
| Ref 528209 | J Med Chem. 2006 Jun 1;49(11):3101-15.Novel bis(1H-indol-2-yl)methanones as potent inhibitors of FLT3 and platelet-derived growth factor receptor tyrosine kinase. | ||||
| Ref 528317 | Aromatic interactions with phenylalanine 691 and cysteine 828: a concept for FMS-like tyrosine kinase-3 inhibition. Application to the discovery of a new class of potential antileukemia agents. J MedChem. 2006 Jul 27;49(15):4451-4. | ||||
| Ref 528330 | A phase 2 trial of the FLT3 inhibitor lestaurtinib (CEP701) as first-line treatment for older patients with acute myeloid leukemia not considered fit for intensive chemotherapy. Blood. 2006 Nov 15;108(10):3262-70. Epub 2006 Jul 20. | ||||
| Ref 528608 | Bioorg Med Chem. 2007 Mar 1;15(5):2187-97. Epub 2006 Dec 12.Inhibition of FLT3 and PDGFR tyrosine kinase activity by bis(benzo[b]furan-2-yl)methanones. | ||||
| Ref 528716 | J Med Chem. 2007 Apr 5;50(7):1584-97. Epub 2007 Mar 8.Discovery of N-(4-(3-amino-1H-indazol-4-yl)phenyl)-N'-(2-fluoro-5-methylphenyl)urea (ABT-869), a 3-aminoindazole-based orally active multitargeted receptor tyrosine kinase inhibitor. | ||||
| Ref 529136 | Lestaurtinib (CEP701) is a JAK2 inhibitor that suppresses JAK2/STAT5 signaling and the proliferation of primary erythroid cells from patients with myeloproliferative disorders. Blood. 2008 Jun 15;111(12):5663-71. Epub 2007 Nov 5. | ||||
| Ref 530222 | KW-2449, a novel multikinase inhibitor, suppresses the growth of leukemia cells with FLT3 mutations or T315I-mutated BCR/ABL translocation. Blood. 2009 Aug 20;114(8):1607-17. | ||||
| Ref 530495 | JNJ-28312141, a novel orally active colony-stimulating factor-1 receptor/FMS-related receptor tyrosine kinase-3 receptor tyrosine kinase inhibitor with potential utility in solid tumors, bone metastases, and acute myeloid leukemia. Mol Cancer Ther. 2009 Nov;8(11):3151-61. | ||||
| Ref 530685 | Targeting FMS-related tyrosine kinase receptor 3 with the human immunoglobulin G1 monoclonal antibody IMC-EB10. Cancer. 2010 Feb 15;116(4 Suppl):1013-7. | ||||
| Ref 530708 | MK-2461, a novel multitargeted kinase inhibitor, preferentially inhibits the activated c-Met receptor. Cancer Res. 2010 Feb 15;70(4):1524-33. | ||||
| Ref 530732 | Preclinical pharmacokinetics and in vitro metabolism of BMS-690514, a potent inhibitor of EGFR and VEGFR2. J Pharm Sci. 2010 Aug;99(8):3579-93. | ||||
| Ref 531649 | 7-(4H-1,2,4-Triazol-3-yl)benzo[c][2,6]naphthyridines: a novel class of Pim kinase inhibitors with potent cell antiproliferative activity. Bioorg Med Chem Lett. 2011 Nov 15;21(22):6687-92. | ||||
| Ref 531679 | Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol. 2011 Oct 30;29(11):1046-51. | ||||
| Ref 531959 | The design, synthesis, and biological evaluation of potent receptor tyrosine kinase inhibitors. Bioorg Med Chem Lett. 2012 Aug 1;22(15):4979-85. | ||||
| Ref 532104 | Metabolism and bioactivation of famitinib, a novel inhibitor of receptor tyrosine kinase, in cancer patients. Br J Pharmacol. 2013 Apr;168(7):1687-706. | ||||
| Ref 532479 | Discovery, synthesis, and characterization of an orally bioavailable, brain penetrant inhibitor of mixed lineage kinase 3. J Med Chem. 2013 Oct 24;56(20):8032-48. | ||||
| Ref 532674 | G-749, a novel FLT3 kinase inhibitor, can overcome drug resistance for the treatment of acute myeloid leukemia. Blood. 2014 Apr 3;123(14):2209-19. | ||||
| Ref 532818 | Discovery of Disubstituted Imidazo[4,5-b]pyridines and Purines as Potent TrkA Inhibitors. ACS Med Chem Lett. 2012 Jul 26;3(9):705-9. | ||||
| Ref 533222 | Efficacy and safety of CDX-301, recombinant human Flt3L, at expanding dendritic cells and hematopoietic stem cells in healthy human volunteers. Bone Marrow Transplant. 2015 Jul;50(7):924-30. | ||||
| Ref 536065 | Identification of Ki23819, a highly potent inhibitor of kinase activity of mutant FLT3 receptor tyrosine kinase. Leukemia. 2005 Jun;19(6):930-5. | ||||
| Ref 536474 | A comparison of physicochemical property profiles of marketed oral drugs and orally bioavailable anti-cancer protein kinase inhibitors in clinical development. Curr Top Med Chem. 2007;7(14):1408-22. | ||||
| Ref 537142 | CBL exon 8/9 mutants activate the FLT3 pathway and cluster in core binding factor/11q deletion acute myeloid leukemia/myelodysplastic syndrome subtypes. Clin Cancer Res. 2009 Apr 1;15(7):2238-47. Epub 2009 Mar 10. | ||||
| Ref 537173 | FMS-like tyrosine kinase 3-internal tandem duplication tyrosine kinase inhibitors display a nonoverlapping profile of resistance mutations in vitro. Cancer Res. 2009 Apr 1;69(7):3032-41. Epub 2009 Mar 24. | ||||
| Ref 543494 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1807). | ||||
| Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
