Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3C1JY)

DME Name	Nitric oxide synthase inducible (NOS2)
Synonyms	Peptidyl-cysteine S-nitrosylase NOS2; Hepatocyte NOS; Inducible nitric oxide synthase; Inducible NO synthase; Inducible NOS; NOS2A; NOS type II; NOS2; HEP-NOS; iNOS
Gene Name	NOS2
UniProt ID	NOS2_HUMAN
INTEDE ID	DME0124
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	4843
EC Number	EC: 1.14.13.39 Oxidoreductase Oxygen paired donor oxidoreductase NADH/NADPH donor oxidoreductase EC: 1.14.13.39
Lineage	Species: Homo sapiens Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Sequence	MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR VAVQPSSLEMSAL
Function	This enzyme has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such PTGS2/COX2.
KEGG Pathway	Alzheimer's disease (hsa05010 ) Amoebiasis (hsa05146 ) Apelin signaling pathway (hsa04371 ) Arginine and proline metabolism (hsa00330 ) Arginine biosynthesis (hsa00220 ) Calcium signaling pathway (hsa04020 ) Chagas disease (American trypanosomiasis) (hsa05142 ) HIF-1 signaling pathway (hsa04066 ) Leishmaniasis (hsa05140 ) Metabolic pathways (hsa01100 ) Pathways in cancer (hsa05200 ) Peroxisome (hsa04146 ) Pertussis (hsa05133 ) Relaxin signaling pathway (hsa04926 ) Small cell lung cancer (hsa05222 ) Toxoplasmosis (hsa05145 ) Tuberculosis (hsa05152 )
Reactome Pathway	Nitric oxide stimulates guanylate cyclase (R-HSA-392154 ) Peroxisomal protein import (R-HSA-9033241 ) ROS and RNS production in phagocytes (R-HSA-1222556 ) Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DME

1 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Doxorubicin	DMVP5YE	Solid tumour/cancer	2A00-2F9Z	Approved	[43]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	4.41E-01	2.87E-02	1.31E-01
Alopecia	ED70	Skin from scalp	7.11E-03	-1.45E-01	-5.80E-01
Alzheimer's disease	8A20	Entorhinal cortex	1.97E-06	-9.19E-02	-3.71E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	9.89E-01	3.71E-02	2.83E-01
Aortic stenosis	BB70	Calcified aortic valve	3.89E-01	-4.08E-02	-7.72E-02
Apnea	7A40	Hyperplastic tonsil	6.02E-01	-7.83E-03	-3.54E-02
Arthropathy	FA00-FA5Z	Peripheral blood	4.71E-01	4.75E-02	4.14E-01
Asthma	CA23	Nasal and bronchial airway	5.49E-08	7.40E-01	7.02E-01
Atopic dermatitis	EA80	Skin	3.27E-02	3.77E-02	3.36E-01
Autism	6A02	Whole blood	7.93E-01	6.99E-02	3.05E-01
Autoimmune uveitis	9A96	Peripheral monocyte	9.66E-01	4.30E-02	2.49E-01
Autosomal dominant monocytopenia	4B04	Whole blood	2.47E-01	-7.25E-02	-8.86E-01
Bacterial infection of gingival	1C1H	Gingival tissue	8.65E-01	5.45E-02	2.37E-01
Batten disease	5C56.1	Whole blood	3.24E-01	5.59E-02	5.95E-01
Behcet's disease	4A62	Peripheral blood	8.97E-01	1.51E-02	7.16E-02
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	9.03E-01	1.07E-02	4.46E-02
Bladder cancer	2C94	Bladder tissue	4.17E-03	2.54E-01	1.49E+00
Breast cancer	2C60-2C6Z	Breast tissue	2.62E-02	2.63E-02	1.21E-01
Cardioembolic stroke	8B11.20	Whole blood	1.40E-01	-2.77E-03	-1.84E-02
Cervical cancer	2C77	Cervical tissue	1.60E-02	-9.27E-02	-5.85E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	2.07E-01	5.00E-02	2.35E-01
Chronic hepatitis C	1E51.1	Whole blood	8.85E-01	4.16E-02	2.33E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	6.77E-01	5.11E-02	1.97E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	3.47E-05	-2.81E-01	-3.84E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	3.11E-02	-1.80E+00	-1.60E+00
Colon cancer	2B90	Colon tissue	8.56E-01	-7.63E-02	-1.54E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	9.15E-01	-2.34E-02	-9.17E-02
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	5.17E-01	-6.94E-02	-2.94E-01
Endometriosis	GA10	Endometrium tissue	8.18E-01	-1.69E-02	-7.22E-02
Familial hypercholesterolemia	5C80.00	Peripheral blood	3.92E-01	1.02E-01	5.90E-01
Familial hypercholesterolemia	5C80.00	Whole blood	3.03E-03	-2.49E-01	-7.58E-01
Gastric cancer	2B72	Gastric tissue	2.34E-01	1.08E-01	3.15E-01
Glioblastopma	2A00.00	Nervous tissue	8.08E-13	-2.33E-01	-6.16E-01
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	5.99E-01	-1.33E-01	-5.16E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	7.90E-01	0.00E+00	0.00E+00
Head and neck cancer	2D42	Head and neck tissue	1.01E-10	-3.95E-01	-5.38E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	3.73E-01	-2.32E-02	-8.60E-02
Huntington's disease	8A01.10	Whole blood	2.07E-01	4.90E-02	3.03E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	3.01E-01	-4.45E-02	-3.29E-01
Immunodeficiency	4A00-4A20	Peripheral blood	8.75E-01	1.39E-02	1.15E-01
Influenza	1E30	Whole blood	6.72E-02	1.95E-01	1.56E+00
Interstitial cystitis	GC00.3	Bladder tissue	7.94E-02	1.52E-01	1.13E+00
Intracranial aneurysm	8B01.0	Intracranial artery	8.25E-01	-1.02E-02	-2.80E-02
Irritable bowel syndrome	DD91.0	Rectal colon tissue	8.12E-01	-1.29E-01	-4.03E-01
Ischemic stroke	8B11	Peripheral blood	2.24E-01	9.98E-03	5.54E-02
Juvenile idiopathic arthritis	FA24	Peripheral blood	1.54E-02	8.05E-02	2.99E-01
Lateral sclerosis	8B60.4	Skin	7.89E-01	3.25E-02	2.11E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	1.39E-03	3.01E-01	2.29E+00
Liver cancer	2C12.0	Liver tissue	3.91E-01	-1.02E-01	-3.42E-01
Liver failure	DB99.7-DB99.8	Liver tissue	1.38E-02	-2.72E-01	-1.13E+00
Lung cancer	2C25	Lung tissue	4.65E-01	-6.48E-02	-2.89E-01
Lupus erythematosus	4A40	Whole blood	1.08E-02	-1.57E-01	-4.13E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	4.25E-01	5.30E-02	2.09E-01
Major depressive disorder	6A70-6A7Z	Whole blood	2.49E-01	2.15E-02	9.90E-02
Melanoma	2C30	Skin	5.87E-02	-1.31E-01	-3.64E-01
Multiple myeloma	2A83.1	Peripheral blood	3.33E-01	-1.55E-02	-7.10E-02
Multiple myeloma	2A83.1	Bone marrow	9.94E-05	3.82E-01	2.48E+00
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	8.46E-01	1.41E-01	3.45E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	6.71E-02	-1.06E-02	-4.43E-02
Myelofibrosis	2A20.2	Whole blood	8.60E-01	-1.28E-01	-6.78E-01
Myocardial infarction	BA41-BA50	Peripheral blood	1.27E-02	9.29E-02	3.24E-01
Myopathy	8C70.6	Muscle tissue	1.05E-01	-1.99E-01	-1.13E+00
Neonatal sepsis	KA60	Whole blood	6.11E-03	-1.08E-01	-3.78E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	4.01E-02	2.76E-01	5.96E-01
Non-alcoholic fatty liver disease	DB92	Liver tissue	6.34E-01	-6.77E-02	-3.83E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	9.12E-02	-1.04E-01	-8.42E-01
Olive pollen allergy	CA08.00	Peripheral blood	1.48E-01	1.63E-01	7.81E-01
Oral cancer	2B6E	Oral tissue	3.18E-02	-1.61E-01	-5.58E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	4.24E-02	-2.72E-01	-8.80E-01
Osteoporosis	FB83.1	Bone marrow	1.19E-01	2.35E-01	1.14E+00
Ovarian cancer	2C73	Ovarian tissue	5.51E-02	-1.84E-01	-6.46E-01
Pancreatic cancer	2C10	Pancreas	4.56E-03	-2.52E-01	-8.04E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	8.23E-01	-2.16E-02	-1.57E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	2.84E-01	-3.63E-02	-2.73E-01
Pituitary cancer	2D12	Pituitary tissue	1.45E-01	1.74E-01	5.37E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	2.11E-01	1.33E-01	4.22E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	8.15E-01	-5.20E-03	-3.33E-02
Polycythemia vera	2A20.4	Whole blood	6.19E-01	2.24E-02	1.46E-01
Pompe disease	5C51.3	Biceps muscle	5.89E-01	-1.95E-02	-1.35E-01
Preterm birth	KA21.4Z	Myometrium	8.23E-01	2.49E-02	3.83E-01
Prostate cancer	2C82	Prostate	1.04E-02	1.99E-01	6.42E-01
Psoriasis	EA90	Skin	5.22E-35	6.95E-01	2.46E+00
Rectal cancer	2B92	Rectal colon tissue	1.46E-02	7.20E-01	1.81E+00
Renal cancer	2C90-2C91	Kidney	8.94E-02	1.03E-01	6.31E-01
Retinoblastoma	2D02.2	Uvea	6.62E-01	-1.29E-02	-1.11E-01
Rheumatoid arthritis	FA20	Synovial tissue	1.62E-02	-4.48E-01	-1.47E+00
Rhinovirus infection	CA42.1	Nasal epithelium tissue	3.51E-01	-8.41E-02	-1.27E-01
Schizophrenia	6A20	Prefrontal cortex	9.95E-01	1.54E-02	5.13E-02
Schizophrenia	6A20	Superior temporal cortex	7.05E-01	1.15E-02	8.41E-02
Scleroderma	4A42.Z	Whole blood	1.95E-02	2.03E-01	9.67E-01
Seizure	8A60-8A6Z	Whole blood	2.48E-01	-1.03E-01	-4.80E-01
Sensitive skin	EK0Z	Skin	9.43E-01	1.55E-02	1.04E-01
Sepsis with septic shock	1G41	Whole blood	6.14E-01	-7.11E-02	-2.64E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	9.50E-01	-4.91E-02	-4.56E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	3.91E-02	1.91E-01	7.28E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	9.98E-01	4.57E-02	3.33E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	1.34E-01	-4.68E-01	-1.33E+00
Skin cancer	2C30-2C3Z	Skin	6.46E-04	5.42E-02	1.91E-01
Thrombocythemia	3B63	Whole blood	1.01E-01	-6.98E-02	-3.54E-01
Thrombocytopenia	3B64	Whole blood	7.50E-01	5.17E-02	2.38E-01
Thyroid cancer	2D10	Thyroid	9.85E-04	1.09E-01	4.48E-01
Tibial muscular dystrophy	8C75	Muscle tissue	3.79E-06	-5.42E-01	-2.17E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	3.71E-01	-4.77E-02	-2.93E-01
Type 2 diabetes	5A11	Liver tissue	5.54E-01	-3.99E-02	-2.47E-01
Ureter cancer	2C92	Urothelium	2.06E-01	-9.67E-02	-4.64E-01
Uterine cancer	2C78	Endometrium tissue	1.91E-06	-1.32E-01	-5.04E-01
Vitiligo	ED63.0	Skin	5.51E-01	-7.74E-03	-7.00E-02
------------------------------------------------------------------------------------


⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name

Nitric-oxide synthase inducible (NOS2) DTT Info

DME DTT Type

Clinical trial

11 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Curcumin	DMQPH29	Solid tumour/cancer	2A00-2F9Z	Phase 3	[1]
MPL-S	DMNDCFY	Endotoxic shock	1G41	Phase 3	[2]
SD-6010	DM9DEYL	Osteoarthritis	FA00-FA05	Phase 3	[3]
Pimagedine HCl	DMPWH30	Diabetic kidney disease	GB61.Z	Phase 2/3	[4]
BXT-51072	DMD8GNB	Cardiovascular disease	BA00-BE2Z	Phase 2	[5]
CR-3294	DMHJEZS	Diarrhea	ME05.1	Phase 2	[6], [7]
GW274150	DMZMCB1	Asthma	CA23	Phase 2	[8], [9]
HP-228	DMNZ35F	Postoperative pain	MG30-MG3Z	Phase 2	[10]
KD-7040	DME1WV2	Pain	MG30-MG3Z	Phase 2	[11]
LT-1951	DM5N04G	Coronary artery disease	BA80	Phase 1/2	[12]
Aminoguanidine	DMJQDUC	Diabetic retinopathy	9B71.0	Phase 1	[13]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Clinical Trial Drug(s)

3 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NOStentin	DMWDE8K	Artery stenosis	BD52	Discontinued in Phase 1	[14]
ONO-1714	DML7Q56	Sepsis	1G40-1G41	Discontinued in Phase 1	[15], [16]
L-NIL	DM6Y49D	N. A.	N. A.	Terminated	[17]
------------------------------------------------------------------------------------

115 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
((E)-7-But-2-enyl)-azepan-(2Z)-ylideneamine	DMCW65Q	Discovery agent	N.A.	Investigative	[18]
(4S,5R)-4,5-Diethyl-oxazolidin-(2Z)-ylideneamine	DMM6QV5	Discovery agent	N.A.	Investigative	[19]
(4S,5R)-4,5-Dimethyl-oxazolidin-(2Z)-ylideneamine	DM0V9HB	Discovery agent	N.A.	Investigative	[19]
(4S,5R)-4,5-Dipropyl-oxazolidin-(2Z)-ylideneamine	DMDC84U	Discovery agent	N.A.	Investigative	[19]
(4S,5S)-4,5-Diethyl-oxazolidin-(2Z)-ylideneamine	DM1VJUZ	Discovery agent	N.A.	Investigative	[19]
(4S,5S)-4,5-Dipropyl-oxazolidin-(2Z)-ylideneamine	DM5EKF4	Discovery agent	N.A.	Investigative	[19]
(5-Imino-[1,4]thiazepan-3-yl)-methanol	DMBKZDJ	Discovery agent	N.A.	Investigative	[20]
(5S,6R)-[Octahydro-quinolin-(2E)-ylidene]amine	DMT9CXD	Discovery agent	N.A.	Investigative	[21]
(5S,6S)-[Octahydro-quinolin-(2E)-ylidene]amine	DMP4UC1	Discovery agent	N.A.	Investigative	[21]
(6r,1'r,2's)-5,6,7,8 Tetrahydrobiopterin	DMOD9R7	Discovery agent	N.A.	Investigative	[22]
(E)-4-Methyl-6-(prop-1-enyl)pyridin-2-amine	DM75OHG	Discovery agent	N.A.	Investigative	[23]
(R)-3-Propyl-[1,4]thiazepan-(5E)-ylideneamine	DM1Y9MZ	Discovery agent	N.A.	Investigative	[20]
(S)-2-Amino-5-(N-methyl-guanidino)-pentanoic acid	DMZSWDM	Discovery agent	N.A.	Investigative	[24]
(S)-2-Amino-6-[(E)-ethylimino]-hexanoic acid	DMRG80O	Discovery agent	N.A.	Investigative	[24]
(S)-3-Propyl-[1,4]thiazepan-(5E)-ylideneamine	DMIG9H3	Discovery agent	N.A.	Investigative	[20]
(S)-6-Amino-2-(2-imino-ethylamino)-hexanoic acid	DMG58HM	Discovery agent	N.A.	Investigative	[20]
(S)-N-(1-phenylethyl)acetimidamide hydrobromide	DMLR0N3	Discovery agent	N.A.	Investigative	[25]
1-(6-Amino-4-methylpyridin-2-yl)propan-2-ol	DMUS9Z3	Discovery agent	N.A.	Investigative	[23]
1400W	DMLZT64	Discovery agent	N.A.	Investigative	[26], [27], [25]
2-(2-Amino-ethyl)-7-imino-azepane	DM3JM7V	Discovery agent	N.A.	Investigative	[18]
2-amino-4-methylpyridine	DM1OED2	Discovery agent	N.A.	Investigative	[28], [29]
2-Amino-5-(N-nitro-guanidino)-pentanoic acid	DMDUZ2H	Discovery agent	N.A.	Investigative	[24]
2-Aminothiazoline	DM9YCAH	Discovery agent	N.A.	Investigative	[30]
2-Methyl-[1,4]thiazepan-(5E)-ylideneamine	DMX1IC4	Discovery agent	N.A.	Investigative	[20]
3,4-Dihydro-1H-quinolin-(2E)-ylideneamine	DM0I6UT	Discovery agent	N.A.	Investigative	[21]
3,4-Dimethyl-pyrrolidin-(2Z)-ylideneamine	DMMO6QI	Discovery agent	N.A.	Investigative	[30]
3-(2-Amino-ethyl)-5-imino-[1,4]oxazepane	DM95R6O	Discovery agent	N.A.	Investigative	[18]
3-(2-Nitro-ethyl)-[1,4]oxazepan-(5Z)-ylideneamine	DMYXQ7L	Discovery agent	N.A.	Investigative	[18]
3-Bromo-1H-indazole-7-carbonitrile	DMZGWL2	Discovery agent	N.A.	Investigative	[31]
3-bromo-7-nitro-1H-indazole	DMM7DHB	Discovery agent	N.A.	Investigative	[22], [32]
3-Butyl-[1,4]oxazepan-(5Z)-ylideneamine	DMRI503	Discovery agent	N.A.	Investigative	[18]
3-Butyl-[1,4]thiazepan-(5E)-ylideneamine	DM6A80U	Discovery agent	N.A.	Investigative	[20]
3-Ethyl-[1,4]thiazepan-(5E)-ylideneamine	DMX2JKQ	Discovery agent	N.A.	Investigative	[20]
3-Isobutyl-[1,4]thiazepan-(5E)-ylideneamine	DMQXP7C	Discovery agent	N.A.	Investigative	[20]
3-Methyl-pyrrolidin-(2Z)-ylideneamine	DMHVUF8	Discovery agent	N.A.	Investigative	[30]
3-Methyl-[1,4]thiazepan-(5E)-ylideneamine	DMCOH46	Discovery agent	N.A.	Investigative	[20]
3-Propyl-[1,4]thiazepan-(5E)-ylideneamine	DMYACO7	Discovery agent	N.A.	Investigative	[20]
4,5,6,7-tetrafluoro-3-methyl-1H-indazole	DMTC7J2	Discovery agent	N.A.	Investigative	[32]
4,5,6,7-tetrafluoro-3-perfluorophenyl-1H-indazole	DMZEY31	Discovery agent	N.A.	Investigative	[32]
4,5-Dimethyl-pyrrolidin-(2Z)-ylideneamine	DMB9CJM	Discovery agent	N.A.	Investigative	[30]
4-(1H-IMIDAZOL-1-YL)PHENOL	DM5JDYO	Discovery agent	N.A.	Investigative	[27]
4-Butyl-thiazolidin-(2E)-ylideneamine	DMKU4TR	Discovery agent	N.A.	Investigative	[30]
4-Ethyl-3-methyl-pyrrolidin-(2Z)-ylideneamine	DM5G3NU	Discovery agent	N.A.	Investigative	[30]
4-Ethyl-5-methyl-pyrrolidin-(2Z)-ylideneamine	DMOAQ1E	Discovery agent	N.A.	Investigative	[30]
4-Ethyl-oxazolidin-(2Z)-ylideneamine	DMG0Y3W	Discovery agent	N.A.	Investigative	[19]
4-Ethyl-pyrrolidin-(2Z)-ylideneamine	DMYIWAH	Discovery agent	N.A.	Investigative	[30]
4-Isopropyl-pyrrolidin-(2Z)-ylideneamine	DMVTEOQ	Discovery agent	N.A.	Investigative	[30]
4-Methyl-5-propyl-pyrrolidin-(2Z)-ylideneamine	DMN8Z3C	Discovery agent	N.A.	Investigative	[30]
4-Methyl-6-(2-methylprop-1-enyl)pyridin-2-amine	DMW7YHS	Discovery agent	N.A.	Investigative	[23]
4-methyl-6-propylpyridin-2-amine	DMY04D1	Discovery agent	N.A.	Investigative	[29]
4-Methyl-oxazolidin-(2Z)-ylideneamine	DME7W0Q	Discovery agent	N.A.	Investigative	[19]
4-Methyl-piperidin-(2E)-ylideneamine	DMNMXCE	Discovery agent	N.A.	Investigative	[21]
4-Methyl-pyrrolidin-(2Z)-ylideneamine	DM0YS36	Discovery agent	N.A.	Investigative	[30]
4-[(2-Methyl-1H-imidazol-1-yl)methyl]pyridine	DM8BPTQ	Discovery agent	N.A.	Investigative	[25]
4r-Fluoro-N6-Ethanimidoyl-L-Lysine	DMUGFS3	Discovery agent	N.A.	Investigative	[22]
5-Bromomethyl-oxazolidin-(2Z)-ylideneamine	DMH908V	Discovery agent	N.A.	Investigative	[19]
5-Ethyl-4-methyl-pyrrolidin-(2Z)-ylideneamine	DMQWOIG	Discovery agent	N.A.	Investigative	[30]
5-Ethyl-4-propyl-pyrrolidin-(2Z)-ylideneamine	DMSA8X2	Discovery agent	N.A.	Investigative	[30]
5-Ethyl-oxazolidin-(2Z)-ylideneamine	DM8Y4G5	Discovery agent	N.A.	Investigative	[19]
5-Methyl-4-propyl-pyrrolidin-(2Z)-ylideneamine	DM6DEOC	Discovery agent	N.A.	Investigative	[30]
5-Methyl-oxazolidin-(2Z)-ylideneamine	DMBQS31	Discovery agent	N.A.	Investigative	[19]
5-Methyl-pyrrolidin-(2Z)-ylideneamine	DM4QB3G	Discovery agent	N.A.	Investigative	[30]
5-Nitroindazole	DMH7SIX	Discovery agent	N.A.	Investigative	[22]
6-(2-Fluoropropyl)-4-methylpyridin-2-amine	DME1JLM	Discovery agent	N.A.	Investigative	[23]
6-(3-Fluoropropyl)-4-methylpyridin-2-amine	DMTJPZU	Discovery agent	N.A.	Investigative	[23]
6-(4-Fluorobutyl)-4-methylpyridin-2-amine	DM3EDBO	Discovery agent	N.A.	Investigative	[23]
6-isobutyl-4-methylpyridin-2-amine	DM2XB68	Discovery agent	N.A.	Investigative	[23]
6-methyl-5,6-dihydro-4H-1,3-thiazin-2-amine	DMSLT3I	Discovery agent	N.A.	Investigative	[33]
6-Nitroindazole	DM2WZCX	Discovery agent	N.A.	Investigative	[22]
7,8-dihydrobiopterin	DMQU4XM	Discovery agent	N.A.	Investigative	[34], [22]
7-(2-Nitro-ethyl)-azepan-(2Z)-ylideneamine	DMK28IS	Discovery agent	N.A.	Investigative	[18]
7-Butyl-azepan-(2Z)-ylideneamine	DMVTK0A	Discovery agent	N.A.	Investigative	[18]
7-Methyl-[1,4]thiazepan-(5E)-ylideneamine	DMUCJA6	Discovery agent	N.A.	Investigative	[20]
7-nitro-1H-indazole	DMW4XKQ	Discovery agent	N.A.	Investigative	[22], [32]
Aminothiazoline	DMGEVBH	Discovery agent	N.A.	Investigative	[35]
AR-C102222	DMWVULN	Discovery agent	N.A.	Investigative	[29]
AR-C133057XX	DM71WQT	Discovery agent	N.A.	Investigative	[29]
Azepan-(2Z)-ylideneamine	DMZHV39	Discovery agent	N.A.	Investigative	[18]
Azocan-(2Z)-ylideneamine	DMQ13PZ	Discovery agent	N.A.	Investigative	[18]
Azonan-(2Z)-ylideneamine	DMTQSNK	Discovery agent	N.A.	Investigative	[24]
B-Octylglucoside	DMMO75G	Discovery agent	N.A.	Investigative	[22]
BYK-191023	DMAWMDN	Inflammation	1A00-CA43.1	Investigative	[36]
CDDO	DM03NUV	Discovery agent	N.A.	Investigative	[37]
Ethylisothiourea	DMV9OCU	N. A.	N. A.	Investigative	[22]
Heme	DMGC287	Discovery agent	N.A.	Investigative	[27]
Hexahydro-cyclopenta[c]pyrrol-(1Z)-ylideneamine	DMG0UVT	Discovery agent	N.A.	Investigative	[30]
KD-7332	DMJ2X64	Inflammation	1A00-CA43.1	Investigative	[36]
L-NIO	DME9FAV	Discovery agent	N.A.	Investigative	[38]
L-Thiocitrulline	DMP8O6R	Discovery agent	N.A.	Investigative	[22]
N,N-dimethylarginine	DM0Y8OW	Discovery agent	N.A.	Investigative	[39]
N-(5-Amino-6-oxo-heptyl)-acetamidine	DM47XR8	Discovery agent	N.A.	Investigative	[30]
N-benzylacetimidamide hydrobromide	DM26R4P	Discovery agent	N.A.	Investigative	[25]
N-omega-allyl-L-arginine	DM0BPCT	Discovery agent	N.A.	Investigative	[38]
N-Omega-Hydroxy-L-Arginine	DMOXQ3N	Discovery agent	N.A.	Investigative	[22]
N-omega-propargyl-L-arginine	DM9X3B7	Discovery agent	N.A.	Investigative	[38]
N-Omega-Propyl-L-Arginine	DM4X0WY	Discovery agent	N.A.	Investigative	[22]
N5-(1-iminobut-3-enyl)-L-ornithine	DMB62OI	Discovery agent	N.A.	Investigative	[38]
N5-(1-iminobutyl)-L-ornithine	DMT893N	Discovery agent	N.A.	Investigative	[38]
N5-(1-iminopropyl)-L-ornithine	DM05O7J	Discovery agent	N.A.	Investigative	[38]
Octahydro-isoindol-(1Z)-ylideneamine	DM4C70S	Discovery agent	N.A.	Investigative	[30]
Oxazolidin-(2Z)-ylideneamine	DM8109D	Discovery agent	N.A.	Investigative	[19]
PIBTU	DMQBAM6	Discovery agent	N.A.	Investigative	[40]
Piperidin-(2E)-ylideneamine	DMN8OR2	Discovery agent	N.A.	Investigative	[21]
Pyrrolidin-(2Z)-ylideneamine	DMS4ZFU	Discovery agent	N.A.	Investigative	[30]
Resveratrol Potassium4,-Sulfate	DMMFP57	Discovery agent	N.A.	Investigative	[41]
SKLB-010	DMUVAFO	Inflammation	1A00-CA43.1	Investigative	[36]
THIOCITRULLINE	DM7X8MH	Discovery agent	N.A.	Investigative	[42]
Thiocoumarin	DMPTSN0	Discovery agent	N.A.	Investigative	[27]
[1,3]Oxazinan-(2E)-ylideneamine	DMDX6W4	Discovery agent	N.A.	Investigative	[24]
[1,3]Thiazinan-(2E)-ylideneamine	DMOEIHC	Discovery agent	N.A.	Investigative	[24]
[1,4]Oxazepan-(3E)-ylideneamine	DMX58NK	Discovery agent	N.A.	Investigative	[20]
[1,4]Oxazepan-(5E)-ylideneamine	DMMUZVS	Discovery agent	N.A.	Investigative	[20]
[1,4]Thiazepan-(3E)-ylideneamine	DMCBFJQ	Discovery agent	N.A.	Investigative	[20]
[1,4]Thiazepan-(5E)-ylideneamine	DMFQ0Z4	Discovery agent	N.A.	Investigative	[20]
[1,5]Thiazocan-(4E)-ylideneamine	DMF62JR	Discovery agent	N.A.	Investigative	[18]
------------------------------------------------------------------------------------


⏷ Show the Full List of 115 Investigative Drug(s)

References

1	A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases. Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20523-8.
2	Lipopolysaccharide and monophosphoryl lipid A differentially regulate interleukin-12, gamma interferon, and interleukin-10 mRNA production in murine macrophages. Infect Immun. 1997 Aug;65(8):3239-47.
3	A 2-year randomised, double-blind, placebo-controlled, multicentre study of oral selective iNOS inhibitor, cindunistat (SD-6010), in patients with symptomatic osteoarthritis of the knee. Ann Rheum Dis. 2013 Feb;72(2):187-95.
4	Nitric oxide associated with iNOS expression inhibits acetylcholinesterase activity and induces memory impairment during acute hypobaric hypoxia. Brain Res. 2008 Sep 16;1230:138-49.
5	Shear stress induces iNOS expression in cultured smooth muscle cells: role of oxidative stress. Am J Physiol Cell Physiol. 2000 Dec;279(6):C1880-8.
6	Efficacy of CR3294, a new benzamidine derivative, in the prevention of 5-fluorouracil-induced gastrointestinal mucositis and diarrhea in mice. Cancer Chemother Pharmacol. 2010 October; 66(5): 819-827.
7	Efficacy of CR3294, a new benzamidine derivative, in the prevention of 5-fluorouracil-induced gastrointestinal mucositis and diarrhea in mice. Cancer Chemother Pharmacol. 2010 Oct;66(5):819-27.
8	GW274150, a potent and highly selective inhibitor of iNOS, reduces experimental renal ischemia/reperfusion injury. Kidney Int. 2003 Mar;63(3):853-65.
9	GW274150 and GW273629 are potent and highly selective inhibitors of inducible nitric oxide synthase in vitro and in vivo. Br J Pharmacol. 2005 Jun;145(3):301-12.
10	HP-228, a novel synthetic peptide, inhibits the induction of nitric oxide synthase in vivo but not in vitro. J Pharmacol Exp Ther. 1995 Nov;275(2):584-91.
11	WO patent application no. 2014,0214,08, Method for treating cancer by anticancer agent co-administration.
12	Critical role of L-arginine in endothelial cell survival during oxidative stress. Circulation. 2003 May 27;107(20):2607-14.
13	Inhibitory effects of aminoguanidine on thyroid follicular carcinoma development in inflamed capsular regions of rats treated with sulfadimethoxine... Cancer Sci. 2009 Oct;100(10):1794-800.
14	Gene therapy with iNOS provides long-term protection against myocardial infarction without adverse functional consequences. Am J Physiol Heart Circ Physiol. 2006 Feb;290(2):H584-9.
15	ONO-1714, a new inducible nitric oxide synthase inhibitor, attenuates diaphragmatic dysfunction associated with cerulein-induced pancreatitis in rats. Crit Care Med. 2001 Jun;29(6):1215-21.
16	The potent inducible nitric oxide synthase inhibitor ONO-1714 inhibits neuronal NOS and exerts antinociception in rats. Neurosci Lett. 2004 Jul 22;365(2):111-5.
17	Discovery of a series of aminopiperidines as novel iNOS inhibitors. Bioorg Med Chem Lett. 2008 Jan 1;18(1):336-43.
18	Selective heterocyclic amidine inhibitors of human inducible nitric oxide synthase. Bioorg Med Chem Lett. 2001 Oct 8;11(19):2651-3.
19	4,5-Disubstituted-1,3-oxazolidin-2-imine derivatives: a new class of orally bioavailable nitric oxide synthase inhibitor. Bioorg Med Chem Lett. 2004 Jan 19;14(2):313-6.
20	Synthesis of analogs of (1,4)-3- and 5-imino oxazepane, thiazepane, and diazepane as inhibitors of nitric oxide synthases. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5907-11.
21	Bicyclic amidine inhibitors of nitric oxide synthase: discovery of perhydro-iminopyrindine and perhydro-iminoquinoline as potent, orally active inh... Bioorg Med Chem Lett. 2005 Apr 15;15(8):1997-2001.
22	How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
23	Design and synthesis of 2-amino-4-methylpyridine analogues as inhibitors for inducible nitric oxide synthase and in vivo evaluation of [18F]6-(2-fl... J Med Chem. 2009 Apr 23;52(8):2443-53.
24	2-Iminopiperidine and other 2-iminoazaheterocycles as potent inhibitors of human nitric oxide synthase isoforms. J Med Chem. 1996 Feb 2;39(3):669-72.
25	N-Substituted acetamidines and 2-methylimidazole derivatives as selective inhibitors of neuronal nitric oxide synthase. Bioorg Med Chem Lett. 2010 Nov 15;20(22):6495-9.
26	1400W is a slow, tight binding, and highly selective inhibitor of inducible nitric-oxide synthase in vitro and in vivo. J Biol Chem. 1997 Feb 21;272(8):4959-63.
27	The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
28	2-Amino-4-methylpyridine as a potent inhibitor of inducible NO synthase activity in vitro and in vivo. Br J Pharmacol. 1996 Nov;119(6):1101-8.
29	Anchored plasticity opens doors for selective inhibitor design in nitric oxide synthase. Nat Chem Biol. 2008 Nov;4(11):700-7.
30	Evaluation of pyrrolidin-2-imines and 1,3-thiazolidin-2-imines as inhibitors of nitric oxide synthase. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4539-44.
31	Inhibitory effects of a series of 7-substituted-indazoles toward nitric oxide synthases: particular potency of 1H-indazole-7-carbonitrile. Bioorg Med Chem. 2008 Jun 1;16(11):5962-73.
32	Fluorinated indazoles as novel selective inhibitors of nitric oxide synthase (NOS): synthesis and biological evaluation. Bioorg Med Chem. 2009 Sep 1;17(17):6180-7.
33	Synthesis of biflavones having a 6-O-7'' linkage and effects on cyclooxygenase-2 and inducible nitric oxide synthase. Bioorg Med Chem Lett. 2009 Jan 1;19(1):74-6.
34	DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
35	The design, synthesis and biological evaluation of 7-alkoxy-4-heteroarylamino-3-cyanoquinolines as dual inhibitors of c-Src and iNOS. Bioorg Med Chem Lett. 2008 Dec 1;18(23):6206-9.
36	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1250).
37	Studies on the reactivity of CDDO, a promising new chemopreventive and chemotherapeutic agent: implications for a molecular mechanism of action. Bioorg Med Chem Lett. 2005 May 2;15(9):2215-9.
38	Structure-activity relationship of novel and known inhibitors of human dimethylarginine dimethylaminohydrolase-1: alkenyl-amidines as new leads. Bioorg Med Chem. 2008 Dec 15;16(24):10205-9.
39	Homocysteine and asymmetric dimethylarginine (ADMA): biochemically linked but differently related to vascular disease in chronic kidney disease. Clin Chem Lab Med. 2007;45(12):1683-7.
40	Potent and selective inhibition of human nitric oxide synthases. Inhibition by non-amino acid isothioureas. J Biol Chem. 1994 Oct 28;269(43):26669-76.
41	Selective synthesis and biological evaluation of sulfate-conjugated resveratrol metabolites. J Med Chem. 2010 Jul 8;53(13):5033-43.
42	Evaluation of 3-substituted arginine analogs as selective inhibitors of human nitric oxide synthase isozymes. Bioorg Med Chem Lett. 2005 Jun 2;15(11):2881-5.
43	The role of nitric oxide in anthracycline toxicity and prospects for pharmacologic prevention of cardiac damage. FASEB J. 2004 Apr;18(6):664-75.