Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3C1JY)

• DME Name: Nitric oxide synthase inducible (NOS2)
• Synonyms: Peptidyl-cysteine S-nitrosylase NOS2; Hepatocyte NOS; Inducible nitric oxide synthase; Inducible NO synthase; Inducible NOS; NOS2A; NOS type II; NOS2; HEP-NOS; iNOS
• Gene Name: NOS2
• UniProt ID: NOS2_HUMAN
• INTEDE ID: DME0124
• Gene ID: 4843
• EC Number:
  EC: 1.14.13.39
  Oxidoreductase
  Oxygen paired donor oxidoreductase
  NADH/NADPH donor oxidoreductase
  EC: 1.14.13.39
• Lineage:
  Species: Homo sapiens
  Kingdom: Metazoa
  Phylum: Chordata
  Class: Mammalia
  Order: Primates
  Family: Hominidae
  Genus: Homo
  Species: Homo sapiens
• Sequence:
  MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
  VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
  TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
  LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
  RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
  RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
  GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
  AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
  LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
  ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
  NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
  ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
  SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
  PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
  LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
  PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
  VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
  EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
  VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
  VAVQPSSLEMSAL
• Function: This enzyme has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such PTGS2/COX2.
• KEGG Pathway:
  Alzheimer's disease (hsa05010)
  Amoebiasis (hsa05146)
  Apelin signaling pathway (hsa04371)
  Arginine and proline metabolism (hsa00330)
  Arginine biosynthesis (hsa00220)
  Calcium signaling pathway (hsa04020)
  Chagas disease (American trypanosomiasis) (hsa05142)
  HIF-1 signaling pathway (hsa04066)
  Leishmaniasis (hsa05140)
  Metabolic pathways (hsa01100)
  Pathways in cancer (hsa05200)
  Peroxisome (hsa04146)
  Pertussis (hsa05133)
  Relaxin signaling pathway (hsa04926)
  Small cell lung cancer (hsa05222)
  Toxoplasmosis (hsa05145)
  Tuberculosis (hsa05152)
• Reactome Pathway:
  Nitric oxide stimulates guanylate cyclase (R-HSA-392154)
  Peroxisomal protein import (R-HSA-9033241)
  ROS and RNS production in phagocytes (R-HSA-1222556)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)

Molecular Interaction Atlas (MIA) of This DME

1 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Doxorubicin	DMVP5YE	Acute myelogenous leukaemia	2A41	Approved	[40]

Molecular Expression Atlas (MEA) of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	4.41E-01	2.87E-02	1.31E-01
Alopecia	ED70	Skin from scalp	7.11E-03	-1.45E-01	-5.80E-01
Alzheimer's disease	8A20	Entorhinal cortex	1.97E-06	-9.19E-02	-3.71E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	9.89E-01	3.71E-02	2.83E-01
Aortic stenosis	BB70	Calcified aortic valve	3.89E-01	-4.08E-02	-7.72E-02
Apnea	7A40	Hyperplastic tonsil	6.02E-01	-7.83E-03	-3.54E-02
Arthropathy	FA00-FA5Z	Peripheral blood	4.71E-01	4.75E-02	4.14E-01
Asthma	CA23	Nasal and bronchial airway	5.49E-08	7.40E-01	7.02E-01
Atopic dermatitis	EA80	Skin	3.27E-02	3.77E-02	3.36E-01
Autism	6A02	Whole blood	7.93E-01	6.99E-02	3.05E-01
Autoimmune uveitis	9A96	Peripheral monocyte	9.66E-01	4.30E-02	2.49E-01
Autosomal dominant monocytopenia	4B04	Whole blood	2.47E-01	-7.25E-02	-8.86E-01
Bacterial infection of gingival	1C1H	Gingival tissue	8.65E-01	5.45E-02	2.37E-01
Batten disease	5C56.1	Whole blood	3.24E-01	5.59E-02	5.95E-01
Behcet's disease	4A62	Peripheral blood	8.97E-01	1.51E-02	7.16E-02
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	9.03E-01	1.07E-02	4.46E-02
Bladder cancer	2C94	Bladder tissue	4.17E-03	2.54E-01	1.49E+00
Breast cancer	2C60-2C6Z	Breast tissue	2.62E-02	2.63E-02	1.21E-01
Cardioembolic stroke	8B11.20	Whole blood	1.40E-01	-2.77E-03	-1.84E-02
Cervical cancer	2C77	Cervical tissue	1.60E-02	-9.27E-02	-5.85E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	2.07E-01	5.00E-02	2.35E-01
Chronic hepatitis C	1E51.1	Whole blood	8.85E-01	4.16E-02	2.33E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	6.77E-01	5.11E-02	1.97E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	3.47E-05	-2.81E-01	-3.84E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	3.11E-02	-1.80E+00	-1.60E+00
Colon cancer	2B90	Colon tissue	8.56E-01	-7.63E-02	-1.54E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	9.15E-01	-2.34E-02	-9.17E-02
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	5.17E-01	-6.94E-02	-2.94E-01
Endometriosis	GA10	Endometrium tissue	8.18E-01	-1.69E-02	-7.22E-02
Familial hypercholesterolemia	5C80.00	Peripheral blood	3.92E-01	1.02E-01	5.90E-01
Familial hypercholesterolemia	5C80.00	Whole blood	3.03E-03	-2.49E-01	-7.58E-01
Gastric cancer	2B72	Gastric tissue	2.34E-01	1.08E-01	3.15E-01
Glioblastopma	2A00.00	Nervous tissue	8.08E-13	-2.33E-01	-6.16E-01
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	5.99E-01	-1.33E-01	-5.16E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	7.90E-01	0.00E+00	0.00E+00
Head and neck cancer	2D42	Head and neck tissue	1.01E-10	-3.95E-01	-5.38E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	3.73E-01	-2.32E-02	-8.60E-02
Huntington's disease	8A01.10	Whole blood	2.07E-01	4.90E-02	3.03E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	3.01E-01	-4.45E-02	-3.29E-01
Immunodeficiency	4A00-4A20	Peripheral blood	8.75E-01	1.39E-02	1.15E-01
Influenza	1E30	Whole blood	6.72E-02	1.95E-01	1.56E+00
Interstitial cystitis	GC00.3	Bladder tissue	7.94E-02	1.52E-01	1.13E+00
Intracranial aneurysm	8B01.0	Intracranial artery	8.25E-01	-1.02E-02	-2.80E-02
Irritable bowel syndrome	DD91.0	Rectal colon tissue	8.12E-01	-1.29E-01	-4.03E-01
Ischemic stroke	8B11	Peripheral blood	2.24E-01	9.98E-03	5.54E-02
Juvenile idiopathic arthritis	FA24	Peripheral blood	1.54E-02	8.05E-02	2.99E-01
Lateral sclerosis	8B60.4	Skin	7.89E-01	3.25E-02	2.11E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	1.39E-03	3.01E-01	2.29E+00
Liver cancer	2C12.0	Liver tissue	3.91E-01	-1.02E-01	-3.42E-01
Liver failure	DB99.7-DB99.8	Liver tissue	1.38E-02	-2.72E-01	-1.13E+00
Lung cancer	2C25	Lung tissue	4.65E-01	-6.48E-02	-2.89E-01
Lupus erythematosus	4A40	Whole blood	1.08E-02	-1.57E-01	-4.13E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	4.25E-01	5.30E-02	2.09E-01
Major depressive disorder	6A70-6A7Z	Whole blood	2.49E-01	2.15E-02	9.90E-02
Melanoma	2C30	Skin	5.87E-02	-1.31E-01	-3.64E-01
Multiple myeloma	2A83.1	Peripheral blood	3.33E-01	-1.55E-02	-7.10E-02
Multiple myeloma	2A83.1	Bone marrow	9.94E-05	3.82E-01	2.48E+00
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	8.46E-01	1.41E-01	3.45E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	6.71E-02	-1.06E-02	-4.43E-02
Myelofibrosis	2A20.2	Whole blood	8.60E-01	-1.28E-01	-6.78E-01
Myocardial infarction	BA41-BA50	Peripheral blood	1.27E-02	9.29E-02	3.24E-01
Myopathy	8C70.6	Muscle tissue	1.05E-01	-1.99E-01	-1.13E+00
Neonatal sepsis	KA60	Whole blood	6.11E-03	-1.08E-01	-3.78E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	4.01E-02	2.76E-01	5.96E-01
Non-alcoholic fatty liver disease	DB92	Liver tissue	6.34E-01	-6.77E-02	-3.83E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	9.12E-02	-1.04E-01	-8.42E-01
Olive pollen allergy	CA08.00	Peripheral blood	1.48E-01	1.63E-01	7.81E-01
Oral cancer	2B6E	Oral tissue	3.18E-02	-1.61E-01	-5.58E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	4.24E-02	-2.72E-01	-8.80E-01
Osteoporosis	FB83.1	Bone marrow	1.19E-01	2.35E-01	1.14E+00
Ovarian cancer	2C73	Ovarian tissue	5.51E-02	-1.84E-01	-6.46E-01
Pancreatic cancer	2C10	Pancreas	4.56E-03	-2.52E-01	-8.04E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	8.23E-01	-2.16E-02	-1.57E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	2.84E-01	-3.63E-02	-2.73E-01
Pituitary cancer	2D12	Pituitary tissue	1.45E-01	1.74E-01	5.37E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	2.11E-01	1.33E-01	4.22E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	8.15E-01	-5.20E-03	-3.33E-02
Polycythemia vera	2A20.4	Whole blood	6.19E-01	2.24E-02	1.46E-01
Pompe disease	5C51.3	Biceps muscle	5.89E-01	-1.95E-02	-1.35E-01
Preterm birth	KA21.4Z	Myometrium	8.23E-01	2.49E-02	3.83E-01
Prostate cancer	2C82	Prostate	1.04E-02	1.99E-01	6.42E-01
Psoriasis	EA90	Skin	5.22E-35	6.95E-01	2.46E+00
Rectal cancer	2B92	Rectal colon tissue	1.46E-02	7.20E-01	1.81E+00
Renal cancer	2C90-2C91	Kidney	8.94E-02	1.03E-01	6.31E-01
Retinoblastoma	2D02.2	Uvea	6.62E-01	-1.29E-02	-1.11E-01
Rheumatoid arthritis	FA20	Synovial tissue	1.62E-02	-4.48E-01	-1.47E+00
Rhinovirus infection	CA42.1	Nasal epithelium tissue	3.51E-01	-8.41E-02	-1.27E-01
Schizophrenia	6A20	Prefrontal cortex	9.95E-01	1.54E-02	5.13E-02
Schizophrenia	6A20	Superior temporal cortex	7.05E-01	1.15E-02	8.41E-02
Scleroderma	4A42.Z	Whole blood	1.95E-02	2.03E-01	9.67E-01
Seizure	8A60-8A6Z	Whole blood	2.48E-01	-1.03E-01	-4.80E-01
Sensitive skin	EK0Z	Skin	9.43E-01	1.55E-02	1.04E-01
Sepsis with septic shock	1G41	Whole blood	6.14E-01	-7.11E-02	-2.64E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	9.50E-01	-4.91E-02	-4.56E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	3.91E-02	1.91E-01	7.28E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	9.98E-01	4.57E-02	3.33E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	1.34E-01	-4.68E-01	-1.33E+00
Skin cancer	2C30-2C3Z	Skin	6.46E-04	5.42E-02	1.91E-01
Thrombocythemia	3B63	Whole blood	1.01E-01	-6.98E-02	-3.54E-01
Thrombocytopenia	3B64	Whole blood	7.50E-01	5.17E-02	2.38E-01
Thyroid cancer	2D10	Thyroid	9.85E-04	1.09E-01	4.48E-01
Tibial muscular dystrophy	8C75	Muscle tissue	3.79E-06	-5.42E-01	-2.17E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	3.71E-01	-4.77E-02	-2.93E-01
Type 2 diabetes	5A11	Liver tissue	5.54E-01	-3.99E-02	-2.47E-01
Ureter cancer	2C92	Urothelium	2.06E-01	-9.67E-02	-4.64E-01
Uterine cancer	2C78	Endometrium tissue	1.91E-06	-1.32E-01	-5.04E-01
Vitiligo	ED63.0	Skin	5.51E-01	-7.74E-03	-7.00E-02

The Drug Therapeutic Target (DTT) Role of This DME

• DME DTT Name: Nitric-oxide synthase inducible (NOS2) DTT Info
• DME DTT Type: Clinical trial

11 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Curcumin	DMQPH29	Solid tumour/cancer	2A00-2F9Z	Phase 3	[1]
MPL-S	DMNDCFY	Endotoxic shock	1G41	Phase 3	[2]
SD-6010	DM9DEYL	Osteoarthritis	FA00-FA05	Phase 3	[3]
Pimagedine HCl	DMPWH30	Diabetic kidney disease	GB61.Z	Phase 2/3	[4]
BXT-51072	DMD8GNB	Cardiovascular disease	BA00-BE2Z	Phase 2	[5]
CR-3294	DMHJEZS	Diarrhea	ME05.1	Phase 2	[6]
GW274150	DMZMCB1	Asthma	CA23	Phase 2	[7]
HP-228	DMNZ35F	Postoperative pain	MG30-MG3Z	Phase 2	[8]
KD-7040	DME1WV2	Pain	MG30-MG3Z	Phase 2	[9]
LT-1951	DM5N04G	Coronary artery disease	BA80	Phase 1/2	[10]
Aminoguanidine	DMJQDUC	Diabetic retinopathy	9B71.0	Phase 1	[11]

3 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NOStentin	DMWDE8K	Artery stenosis	BD52	Discontinued in Phase 1	[12]
ONO-1714	DML7Q56	Sepsis	1G40-1G41	Discontinued in Phase 1	[13]
L-NIL	DM6Y49D	N. A.	N. A.	Terminated	[14]

115 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
((E)-7-But-2-enyl)-azepan-(2Z)-ylideneamine	DMCW65Q	Discovery agent	N.A.	Investigative	[15]
(4S,5R)-4,5-Diethyl-oxazolidin-(2Z)-ylideneamine	DMM6QV5	Discovery agent	N.A.	Investigative	[16]
(4S,5R)-4,5-Dimethyl-oxazolidin-(2Z)-ylideneamine	DM0V9HB	Discovery agent	N.A.	Investigative	[16]
(4S,5R)-4,5-Dipropyl-oxazolidin-(2Z)-ylideneamine	DMDC84U	Discovery agent	N.A.	Investigative	[16]
(4S,5S)-4,5-Diethyl-oxazolidin-(2Z)-ylideneamine	DM1VJUZ	Discovery agent	N.A.	Investigative	[16]
(4S,5S)-4,5-Dipropyl-oxazolidin-(2Z)-ylideneamine	DM5EKF4	Discovery agent	N.A.	Investigative	[16]
(5-Imino-[1,4]thiazepan-3-yl)-methanol	DMBKZDJ	Discovery agent	N.A.	Investigative	[17]
(5S,6R)-[Octahydro-quinolin-(2E)-ylidene]amine	DMT9CXD	Discovery agent	N.A.	Investigative	[18]
(5S,6S)-[Octahydro-quinolin-(2E)-ylidene]amine	DMP4UC1	Discovery agent	N.A.	Investigative	[18]
(6r,1'r,2's)-5,6,7,8 Tetrahydrobiopterin	DMOD9R7	Discovery agent	N.A.	Investigative	[19]
(E)-4-Methyl-6-(prop-1-enyl)pyridin-2-amine	DM75OHG	Discovery agent	N.A.	Investigative	[20]
(R)-3-Propyl-[1,4]thiazepan-(5E)-ylideneamine	DM1Y9MZ	Discovery agent	N.A.	Investigative	[17]
(S)-2-Amino-5-(N-methyl-guanidino)-pentanoic acid	DMZSWDM	Discovery agent	N.A.	Investigative	[21]
(S)-2-Amino-6-[(E)-ethylimino]-hexanoic acid	DMRG80O	Discovery agent	N.A.	Investigative	[21]
(S)-3-Propyl-[1,4]thiazepan-(5E)-ylideneamine	DMIG9H3	Discovery agent	N.A.	Investigative	[17]
(S)-6-Amino-2-(2-imino-ethylamino)-hexanoic acid	DMG58HM	Discovery agent	N.A.	Investigative	[17]
(S)-N-(1-phenylethyl)acetimidamide hydrobromide	DMLR0N3	Discovery agent	N.A.	Investigative	[22]
1-(6-Amino-4-methylpyridin-2-yl)propan-2-ol	DMUS9Z3	Discovery agent	N.A.	Investigative	[20]
1400W	DMLZT64	Discovery agent	N.A.	Investigative	[23]
2-(2-Amino-ethyl)-7-imino-azepane	DM3JM7V	Discovery agent	N.A.	Investigative	[15]
2-amino-4-methylpyridine	DM1OED2	Discovery agent	N.A.	Investigative	[24]
2-Amino-5-(N-nitro-guanidino)-pentanoic acid	DMDUZ2H	Discovery agent	N.A.	Investigative	[21]
2-Aminothiazoline	DM9YCAH	Discovery agent	N.A.	Investigative	[25]
2-Methyl-[1,4]thiazepan-(5E)-ylideneamine	DMX1IC4	Discovery agent	N.A.	Investigative	[17]
3,4-Dihydro-1H-quinolin-(2E)-ylideneamine	DM0I6UT	Discovery agent	N.A.	Investigative	[18]
3,4-Dimethyl-pyrrolidin-(2Z)-ylideneamine	DMMO6QI	Discovery agent	N.A.	Investigative	[25]
3-(2-Amino-ethyl)-5-imino-[1,4]oxazepane	DM95R6O	Discovery agent	N.A.	Investigative	[15]
3-(2-Nitro-ethyl)-[1,4]oxazepan-(5Z)-ylideneamine	DMYXQ7L	Discovery agent	N.A.	Investigative	[15]
3-Bromo-1H-indazole-7-carbonitrile	DMZGWL2	Discovery agent	N.A.	Investigative	[26]
3-bromo-7-nitro-1H-indazole	DMM7DHB	Discovery agent	N.A.	Investigative	[19]
3-Butyl-[1,4]oxazepan-(5Z)-ylideneamine	DMRI503	Discovery agent	N.A.	Investigative	[15]
3-Butyl-[1,4]thiazepan-(5E)-ylideneamine	DM6A80U	Discovery agent	N.A.	Investigative	[17]
3-Ethyl-[1,4]thiazepan-(5E)-ylideneamine	DMX2JKQ	Discovery agent	N.A.	Investigative	[17]
3-Isobutyl-[1,4]thiazepan-(5E)-ylideneamine	DMQXP7C	Discovery agent	N.A.	Investigative	[17]
3-Methyl-pyrrolidin-(2Z)-ylideneamine	DMHVUF8	Discovery agent	N.A.	Investigative	[25]
3-Methyl-[1,4]thiazepan-(5E)-ylideneamine	DMCOH46	Discovery agent	N.A.	Investigative	[17]
3-Propyl-[1,4]thiazepan-(5E)-ylideneamine	DMYACO7	Discovery agent	N.A.	Investigative	[17]
4,5,6,7-tetrafluoro-3-methyl-1H-indazole	DMTC7J2	Discovery agent	N.A.	Investigative	[27]
4,5,6,7-tetrafluoro-3-perfluorophenyl-1H-indazole	DMZEY31	Discovery agent	N.A.	Investigative	[27]
4,5-Dimethyl-pyrrolidin-(2Z)-ylideneamine	DMB9CJM	Discovery agent	N.A.	Investigative	[25]
4-(1H-IMIDAZOL-1-YL)PHENOL	DM5JDYO	Discovery agent	N.A.	Investigative	[28]
4-Butyl-thiazolidin-(2E)-ylideneamine	DMKU4TR	Discovery agent	N.A.	Investigative	[25]
4-Ethyl-3-methyl-pyrrolidin-(2Z)-ylideneamine	DM5G3NU	Discovery agent	N.A.	Investigative	[25]
4-Ethyl-5-methyl-pyrrolidin-(2Z)-ylideneamine	DMOAQ1E	Discovery agent	N.A.	Investigative	[25]
4-Ethyl-oxazolidin-(2Z)-ylideneamine	DMG0Y3W	Discovery agent	N.A.	Investigative	[16]
4-Ethyl-pyrrolidin-(2Z)-ylideneamine	DMYIWAH	Discovery agent	N.A.	Investigative	[25]
4-Isopropyl-pyrrolidin-(2Z)-ylideneamine	DMVTEOQ	Discovery agent	N.A.	Investigative	[25]
4-Methyl-5-propyl-pyrrolidin-(2Z)-ylideneamine	DMN8Z3C	Discovery agent	N.A.	Investigative	[25]
4-Methyl-6-(2-methylprop-1-enyl)pyridin-2-amine	DMW7YHS	Discovery agent	N.A.	Investigative	[20]
4-methyl-6-propylpyridin-2-amine	DMY04D1	Discovery agent	N.A.	Investigative	[29]
4-Methyl-oxazolidin-(2Z)-ylideneamine	DME7W0Q	Discovery agent	N.A.	Investigative	[16]
4-Methyl-piperidin-(2E)-ylideneamine	DMNMXCE	Discovery agent	N.A.	Investigative	[18]
4-Methyl-pyrrolidin-(2Z)-ylideneamine	DM0YS36	Discovery agent	N.A.	Investigative	[25]
4-[(2-Methyl-1H-imidazol-1-yl)methyl]pyridine	DM8BPTQ	Discovery agent	N.A.	Investigative	[22]
4r-Fluoro-N6-Ethanimidoyl-L-Lysine	DMUGFS3	Discovery agent	N.A.	Investigative	[19]
5-Bromomethyl-oxazolidin-(2Z)-ylideneamine	DMH908V	Discovery agent	N.A.	Investigative	[16]
5-Ethyl-4-methyl-pyrrolidin-(2Z)-ylideneamine	DMQWOIG	Discovery agent	N.A.	Investigative	[25]
5-Ethyl-4-propyl-pyrrolidin-(2Z)-ylideneamine	DMSA8X2	Discovery agent	N.A.	Investigative	[25]
5-Ethyl-oxazolidin-(2Z)-ylideneamine	DM8Y4G5	Discovery agent	N.A.	Investigative	[16]
5-Methyl-4-propyl-pyrrolidin-(2Z)-ylideneamine	DM6DEOC	Discovery agent	N.A.	Investigative	[25]
5-Methyl-oxazolidin-(2Z)-ylideneamine	DMBQS31	Discovery agent	N.A.	Investigative	[16]
5-Methyl-pyrrolidin-(2Z)-ylideneamine	DM4QB3G	Discovery agent	N.A.	Investigative	[25]
5-Nitroindazole	DMH7SIX	Discovery agent	N.A.	Investigative	[19]
6-(2-Fluoropropyl)-4-methylpyridin-2-amine	DME1JLM	Discovery agent	N.A.	Investigative	[20]
6-(3-Fluoropropyl)-4-methylpyridin-2-amine	DMTJPZU	Discovery agent	N.A.	Investigative	[20]
6-(4-Fluorobutyl)-4-methylpyridin-2-amine	DM3EDBO	Discovery agent	N.A.	Investigative	[20]
6-isobutyl-4-methylpyridin-2-amine	DM2XB68	Discovery agent	N.A.	Investigative	[20]
6-methyl-5,6-dihydro-4H-1,3-thiazin-2-amine	DMSLT3I	Discovery agent	N.A.	Investigative	[30]
6-Nitroindazole	DM2WZCX	Discovery agent	N.A.	Investigative	[19]
7,8-dihydrobiopterin	DMQU4XM	Discovery agent	N.A.	Investigative	[31]
7-(2-Nitro-ethyl)-azepan-(2Z)-ylideneamine	DMK28IS	Discovery agent	N.A.	Investigative	[15]
7-Butyl-azepan-(2Z)-ylideneamine	DMVTK0A	Discovery agent	N.A.	Investigative	[15]
7-Methyl-[1,4]thiazepan-(5E)-ylideneamine	DMUCJA6	Discovery agent	N.A.	Investigative	[17]
7-nitro-1H-indazole	DMW4XKQ	Discovery agent	N.A.	Investigative	[19]
Aminothiazoline	DMGEVBH	Discovery agent	N.A.	Investigative	[32]
AR-C102222	DMWVULN	Discovery agent	N.A.	Investigative	[29]
AR-C133057XX	DM71WQT	Discovery agent	N.A.	Investigative	[29]
Azepan-(2Z)-ylideneamine	DMZHV39	Discovery agent	N.A.	Investigative	[15]
Azocan-(2Z)-ylideneamine	DMQ13PZ	Discovery agent	N.A.	Investigative	[15]
Azonan-(2Z)-ylideneamine	DMTQSNK	Discovery agent	N.A.	Investigative	[21]
B-Octylglucoside	DMMO75G	Discovery agent	N.A.	Investigative	[19]
BYK-191023	DMAWMDN	Inflammation	1A00-CA43.1	Investigative	[33]
CDDO	DM03NUV	Discovery agent	N.A.	Investigative	[34]
Ethylisothiourea	DMV9OCU	N. A.	N. A.	Investigative	[19]
Heme	DMGC287	Discovery agent	N.A.	Investigative	[28]
Hexahydro-cyclopenta[c]pyrrol-(1Z)-ylideneamine	DMG0UVT	Discovery agent	N.A.	Investigative	[25]
KD-7332	DMJ2X64	Inflammation	1A00-CA43.1	Investigative	[33]
L-NIO	DME9FAV	Discovery agent	N.A.	Investigative	[35]
L-Thiocitrulline	DMP8O6R	Discovery agent	N.A.	Investigative	[19]
N,N-dimethylarginine	DM0Y8OW	Discovery agent	N.A.	Investigative	[36]
N-(5-Amino-6-oxo-heptyl)-acetamidine	DM47XR8	Discovery agent	N.A.	Investigative	[25]
N-benzylacetimidamide hydrobromide	DM26R4P	Discovery agent	N.A.	Investigative	[22]
N-omega-allyl-L-arginine	DM0BPCT	Discovery agent	N.A.	Investigative	[35]
N-Omega-Hydroxy-L-Arginine	DMOXQ3N	Discovery agent	N.A.	Investigative	[19]
N-omega-propargyl-L-arginine	DM9X3B7	Discovery agent	N.A.	Investigative	[35]
N-Omega-Propyl-L-Arginine	DM4X0WY	Discovery agent	N.A.	Investigative	[19]
N5-(1-iminobut-3-enyl)-L-ornithine	DMB62OI	Discovery agent	N.A.	Investigative	[35]
N5-(1-iminobutyl)-L-ornithine	DMT893N	Discovery agent	N.A.	Investigative	[35]
N5-(1-iminopropyl)-L-ornithine	DM05O7J	Discovery agent	N.A.	Investigative	[35]
Octahydro-isoindol-(1Z)-ylideneamine	DM4C70S	Discovery agent	N.A.	Investigative	[25]
Oxazolidin-(2Z)-ylideneamine	DM8109D	Discovery agent	N.A.	Investigative	[16]
PIBTU	DMQBAM6	Discovery agent	N.A.	Investigative	[37]
Piperidin-(2E)-ylideneamine	DMN8OR2	Discovery agent	N.A.	Investigative	[18]
Pyrrolidin-(2Z)-ylideneamine	DMS4ZFU	Discovery agent	N.A.	Investigative	[25]
Resveratrol Potassium4,-Sulfate	DMMFP57	Discovery agent	N.A.	Investigative	[38]
SKLB-010	DMUVAFO	Inflammation	1A00-CA43.1	Investigative	[33]
THIOCITRULLINE	DM7X8MH	Discovery agent	N.A.	Investigative	[39]
Thiocoumarin	DMPTSN0	Discovery agent	N.A.	Investigative	[28]
[1,3]Oxazinan-(2E)-ylideneamine	DMDX6W4	Discovery agent	N.A.	Investigative	[21]
[1,3]Thiazinan-(2E)-ylideneamine	DMOEIHC	Discovery agent	N.A.	Investigative	[21]
[1,4]Oxazepan-(3E)-ylideneamine	DMX58NK	Discovery agent	N.A.	Investigative	[17]
[1,4]Oxazepan-(5E)-ylideneamine	DMMUZVS	Discovery agent	N.A.	Investigative	[17]
[1,4]Thiazepan-(3E)-ylideneamine	DMCBFJQ	Discovery agent	N.A.	Investigative	[17]
[1,4]Thiazepan-(5E)-ylideneamine	DMFQ0Z4	Discovery agent	N.A.	Investigative	[17]
[1,5]Thiazocan-(4E)-ylideneamine	DMF62JR	Discovery agent	N.A.	Investigative	[15]

References

• [1] A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases. Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20523-8.
• [2] Lipopolysaccharide and monophosphoryl lipid A differentially regulate interleukin-12, gamma interferon, and interleukin-10 mRNA production in murine macrophages. Infect Immun. 1997 Aug;65(8):3239-47.
• [3] A 2-year randomised, double-blind, placebo-controlled, multicentre study of oral selective iNOS inhibitor, cindunistat (SD-6010), in patients with symptomatic osteoarthritis of the knee. Ann Rheum Dis. 2013 Feb;72(2):187-95.
• [4] Nitric oxide associated with iNOS expression inhibits acetylcholinesterase activity and induces memory impairment during acute hypobaric hypoxia. Brain Res. 2008 Sep 16;1230:138-49.
• [5] Shear stress induces iNOS expression in cultured smooth muscle cells: role of oxidative stress. Am J Physiol Cell Physiol. 2000 Dec;279(6):C1880-8.
• [6] Efficacy of CR3294, a new benzamidine derivative, in the prevention of 5-fluorouracil-induced gastrointestinal mucositis and diarrhea in mice. Cancer Chemother Pharmacol. 2010 October; 66(5): 819-827.
• [7] GW274150, a potent and highly selective inhibitor of iNOS, reduces experimental renal ischemia/reperfusion injury. Kidney Int. 2003 Mar;63(3):853-65.
• [8] HP-228, a novel synthetic peptide, inhibits the induction of nitric oxide synthase in vivo but not in vitro. J Pharmacol Exp Ther. 1995 Nov;275(2):584-91.
• [9] WO patent application no. 2014,0214,08, Method for treating cancer by anticancer agent co-administration.
• [10] Critical role of L-arginine in endothelial cell survival during oxidative stress. Circulation. 2003 May 27;107(20):2607-14.
• [11] Inhibitory effects of aminoguanidine on thyroid follicular carcinoma development in inflamed capsular regions of rats treated with sulfadimethoxine... Cancer Sci. 2009 Oct;100(10):1794-800.
• [12] Gene therapy with iNOS provides long-term protection against myocardial infarction without adverse functional consequences. Am J Physiol Heart Circ Physiol. 2006 Feb;290(2):H584-9.
• [13] ONO-1714, a new inducible nitric oxide synthase inhibitor, attenuates diaphragmatic dysfunction associated with cerulein-induced pancreatitis in rats. Crit Care Med. 2001 Jun;29(6):1215-21.
• [14] Discovery of a series of aminopiperidines as novel iNOS inhibitors. Bioorg Med Chem Lett. 2008 Jan 1;18(1):336-43.
• [15] Selective heterocyclic amidine inhibitors of human inducible nitric oxide synthase. Bioorg Med Chem Lett. 2001 Oct 8;11(19):2651-3.
• [16] 4,5-Disubstituted-1,3-oxazolidin-2-imine derivatives: a new class of orally bioavailable nitric oxide synthase inhibitor. Bioorg Med Chem Lett. 2004 Jan 19;14(2):313-6.
• [17] Synthesis of analogs of (1,4)-3- and 5-imino oxazepane, thiazepane, and diazepane as inhibitors of nitric oxide synthases. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5907-11.
• [18] Bicyclic amidine inhibitors of nitric oxide synthase: discovery of perhydro-iminopyrindine and perhydro-iminoquinoline as potent, orally active inh... Bioorg Med Chem Lett. 2005 Apr 15;15(8):1997-2001.
• [19] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [20] Design and synthesis of 2-amino-4-methylpyridine analogues as inhibitors for inducible nitric oxide synthase and in vivo evaluation of [18F]6-(2-fl... J Med Chem. 2009 Apr 23;52(8):2443-53.
• [21] 2-Iminopiperidine and other 2-iminoazaheterocycles as potent inhibitors of human nitric oxide synthase isoforms. J Med Chem. 1996 Feb 2;39(3):669-72.
• [22] N-Substituted acetamidines and 2-methylimidazole derivatives as selective inhibitors of neuronal nitric oxide synthase. Bioorg Med Chem Lett. 2010 Nov 15;20(22):6495-9.
• [23] 1400W is a slow, tight binding, and highly selective inhibitor of inducible nitric-oxide synthase in vitro and in vivo. J Biol Chem. 1997 Feb 21;272(8):4959-63.
• [24] 2-Amino-4-methylpyridine as a potent inhibitor of inducible NO synthase activity in vitro and in vivo. Br J Pharmacol. 1996 Nov;119(6):1101-8.
• [25] Evaluation of pyrrolidin-2-imines and 1,3-thiazolidin-2-imines as inhibitors of nitric oxide synthase. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4539-44.
• [26] Inhibitory effects of a series of 7-substituted-indazoles toward nitric oxide synthases: particular potency of 1H-indazole-7-carbonitrile. Bioorg Med Chem. 2008 Jun 1;16(11):5962-73.
• [27] Fluorinated indazoles as novel selective inhibitors of nitric oxide synthase (NOS): synthesis and biological evaluation. Bioorg Med Chem. 2009 Sep 1;17(17):6180-7.
• [28] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [29] Anchored plasticity opens doors for selective inhibitor design in nitric oxide synthase. Nat Chem Biol. 2008 Nov;4(11):700-7.
• [30] Synthesis of biflavones having a 6-O-7'' linkage and effects on cyclooxygenase-2 and inducible nitric oxide synthase. Bioorg Med Chem Lett. 2009 Jan 1;19(1):74-6.
• [31] DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
• [32] The design, synthesis and biological evaluation of 7-alkoxy-4-heteroarylamino-3-cyanoquinolines as dual inhibitors of c-Src and iNOS. Bioorg Med Chem Lett. 2008 Dec 1;18(23):6206-9.
• [33] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1250).
• [34] Studies on the reactivity of CDDO, a promising new chemopreventive and chemotherapeutic agent: implications for a molecular mechanism of action. Bioorg Med Chem Lett. 2005 May 2;15(9):2215-9.
• [35] Structure-activity relationship of novel and known inhibitors of human dimethylarginine dimethylaminohydrolase-1: alkenyl-amidines as new leads. Bioorg Med Chem. 2008 Dec 15;16(24):10205-9.
• [36] Homocysteine and asymmetric dimethylarginine (ADMA): biochemically linked but differently related to vascular disease in chronic kidney disease. Clin Chem Lab Med. 2007;45(12):1683-7.
• [37] Potent and selective inhibition of human nitric oxide synthases. Inhibition by non-amino acid isothioureas. J Biol Chem. 1994 Oct 28;269(43):26669-76.
• [38] Selective synthesis and biological evaluation of sulfate-conjugated resveratrol metabolites. J Med Chem. 2010 Jul 8;53(13):5033-43.
• [39] Evaluation of 3-substituted arginine analogs as selective inhibitors of human nitric oxide synthase isozymes. Bioorg Med Chem Lett. 2005 Jun 2;15(11):2881-5.
• [40] The role of nitric oxide in anthracycline toxicity and prospects for pharmacologic prevention of cardiac damage. FASEB J. 2004 Apr;18(6):664-75.