Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE708H2)

DME Name Nitric oxide synthase endothelial (NOS3)
Synonyms Peptidyl-cysteine S-nitrosylase NOS3; Endothelial NOS; Endothelial nitric oxide synthase; EC-NOS; cNOS; eNOS; NOS type III; NOS3; NOSIII
Gene Name NOS3
UniProt ID
NOS3_HUMAN
INTEDE ID
DME0123
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4846
EC Number EC: 1.14.13.39
Oxidoreductase
Oxygen paired donor oxidoreductase
NADH/NADPH donor oxidoreductase
EC: 1.14.13.39
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLT
QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP
EQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDDPP
ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW
KGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA
RDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP
PPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE
PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT
NSP
Function
This enzyme is one of three isoforms that synthesize nitric oxide (NO). It is a dimer containing two identical monomers of 134 kD constituted by a reductase domain, which displays binding sites for nicotinamide adenine dinucleotide phosphate (NADPH), flavin mononucleotide (FMN), and flavin adenine dinucleotide (FAD), and an oxidase domain, which displays binding sites for heme group, zinc, the cofactor tetrahydrobiopterin (BH4), and the substrate L-arginine. NO is synthesized by eNOS from L-arginine and molecular oxygen, which binds to the heme group of eNOS, is reduced and finally incorporated into L-arginine to form NO and L-citrulline.
KEGG Pathway
AGE-RAGE signaling pathway in diabetic complications (hsa04933 )
Apelin signaling pathway (hsa04371 )
Arginine and proline metabolism (hsa00330 )
Arginine biosynthesis (hsa00220 )
Calcium signaling pathway (hsa04020 )
Estrogen signaling pathway (hsa04915 )
Fluid shear stress and atherosclerosis (hsa05418 )
HIF-1 signaling pathway (hsa04066 )
Insulin resistance (hsa04931 )
Metabolic pathways (hsa01100 )
Oxytocin signaling pathway (hsa04921 )
PI3K-Akt signaling pathway (hsa04151 )
Platelet activation (hsa04611 )
Relaxin signaling pathway (hsa04926 )
Sphingolipid signaling pathway (hsa04071 )
VEGF signaling pathway (hsa04370 )
cGMP-PKG signaling pathway (hsa04022 )
Reactome Pathway
NOSIP mediated eNOS trafficking (R-HSA-203754 )
NOSTRIN mediated eNOS trafficking (R-HSA-203641 )
Nitric oxide stimulates guanylate cyclase (R-HSA-392154 )
ROS and RNS production in phagocytes (R-HSA-1222556 )
Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation (R-HSA-1474151 )
VEGFR2 mediated vascular permeability (R-HSA-5218920 )
eNOS activation (R-HSA-203615 )
Extra-nuclear estrogen signaling (R-HSA-9009391 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Doxorubicin DMVP5YE Acute myelogenous leukaemia 2A41 Approved [26]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.26E-02 9.15E-02 3.42E-01
Alopecia ED70 Skin from scalp 1.03E-02 -1.71E-01 -6.61E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.19E-01 7.75E-02 1.53E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.49E-01 -1.49E-02 -1.11E-01
Aortic stenosis BB70 Calcified aortic valve 8.31E-01 1.68E-02 2.73E-02
Apnea 7A40 Hyperplastic tonsil 1.14E-02 -3.57E-01 -1.96E+00
Arthropathy FA00-FA5Z Peripheral blood 9.56E-01 8.19E-03 4.15E-02
Asthma CA23 Nasal and bronchial airway 1.02E-01 -9.97E-02 -2.12E-01
Atopic dermatitis EA80 Skin 1.45E-04 4.08E-01 1.07E+00
Autism 6A02 Whole blood 9.78E-01 -2.57E-02 -1.12E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.61E-01 -2.19E-01 -1.15E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.87E-01 -1.13E-01 -6.17E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.39E-13 5.84E-01 1.48E+00
Batten disease 5C56.1 Whole blood 4.60E-02 -2.14E-01 -9.07E-01
Behcet's disease 4A62 Peripheral blood 3.05E-01 -6.42E-02 -1.67E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.52E-01 1.21E-01 4.39E-01
Bladder cancer 2C94 Bladder tissue 9.83E-01 1.40E-01 2.73E-01
Breast cancer 2C60-2C6Z Breast tissue 4.60E-01 -2.92E-02 -5.12E-02
Cardioembolic stroke 8B11.20 Whole blood 8.47E-02 -2.34E-02 -9.86E-02
Cervical cancer 2C77 Cervical tissue 3.11E-02 1.07E-01 5.36E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.59E-01 6.54E-02 3.15E-01
Chronic hepatitis C 1E51.1 Whole blood 1.88E-01 -1.92E-01 -7.62E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.47E-01 -1.82E-01 -3.39E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.85E-05 2.63E-01 5.77E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.59E-01 -1.27E-01 -6.81E-01
Colon cancer 2B90 Colon tissue 1.99E-64 6.41E-01 1.72E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.68E-01 -1.11E-01 -8.52E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.60E-01 2.06E-02 5.81E-02
Endometriosis GA10 Endometrium tissue 2.51E-06 4.50E-01 1.94E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.41E-02 2.97E-02 1.58E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.00E-02 -1.16E-01 -4.35E-01
Gastric cancer 2B72 Gastric tissue 7.45E-02 7.24E-01 2.19E+00
Glioblastopma 2A00.00 Nervous tissue 4.05E-29 -4.17E-01 -7.15E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.48E-01 -3.29E-01 -1.13E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.42E-02 -2.55E-01 -3.82E-01
Head and neck cancer 2D42 Head and neck tissue 1.23E-05 1.56E-01 6.00E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.10E-01 2.01E-02 7.55E-02
Huntington's disease 8A01.10 Whole blood 5.78E-01 8.10E-02 4.69E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.69E-01 -8.51E-02 -1.13E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.82E-01 4.31E-02 1.82E-01
Influenza 1E30 Whole blood 1.58E-01 2.65E-01 2.10E+00
Interstitial cystitis GC00.3 Bladder tissue 9.84E-03 9.62E-01 1.99E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.37E-01 0.00E+00 0.00E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.42E-01 -4.37E-02 -1.91E-01
Ischemic stroke 8B11 Peripheral blood 4.87E-01 3.53E-02 2.16E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.60E-02 -3.27E-02 -1.17E-01
Lateral sclerosis 8B60.4 Skin 2.67E-01 -2.65E-01 -4.21E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.94E-01 -1.12E-01 -6.74E-01
Liver cancer 2C12.0 Liver tissue 2.00E-01 -1.81E-01 -4.11E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.93E-01 3.19E-02 1.87E-01
Lung cancer 2C25 Lung tissue 1.51E-09 -4.67E-01 -8.58E-01
Lupus erythematosus 4A40 Whole blood 1.43E-01 -2.40E-02 -7.76E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.48E-01 6.42E-02 2.40E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.09E-01 -1.98E-02 -7.83E-02
Melanoma 2C30 Skin 6.28E-01 3.69E-02 5.55E-02
Multiple myeloma 2A83.1 Peripheral blood 4.86E-01 -4.34E-02 -1.16E-01
Multiple myeloma 2A83.1 Bone marrow 2.18E-01 -2.21E-01 -6.85E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.21E-01 2.79E-02 1.34E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.64E-02 3.86E-02 2.16E-01
Myelofibrosis 2A20.2 Whole blood 6.79E-01 1.25E-02 8.53E-02
Myocardial infarction BA41-BA50 Peripheral blood 5.55E-01 -1.55E-02 -4.28E-02
Myopathy 8C70.6 Muscle tissue 2.63E-01 -1.81E-01 -9.12E-01
Neonatal sepsis KA60 Whole blood 1.26E-04 -1.63E-01 -5.98E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.10E-01 -9.76E-02 -2.31E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.95E-01 7.04E-02 2.24E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.79E-01 -1.94E-02 -7.01E-02
Olive pollen allergy CA08.00 Peripheral blood 4.33E-01 3.80E-02 1.69E-01
Oral cancer 2B6E Oral tissue 8.12E-01 -5.95E-02 -1.59E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.07E-01 -5.87E-02 -2.53E-01
Osteoporosis FB83.1 Bone marrow 4.06E-01 1.20E-02 7.12E-02
Ovarian cancer 2C73 Ovarian tissue 3.06E-02 2.05E-01 5.04E-01
Pancreatic cancer 2C10 Pancreas 5.10E-01 1.68E-01 2.68E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.65E-01 3.69E-01 7.34E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.78E-01 -1.73E-02 -7.78E-02
Pituitary cancer 2D12 Pituitary tissue 1.32E-01 -3.58E-01 -7.14E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.98E-03 -5.20E-01 -1.05E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.45E-01 2.89E-01 9.69E-01
Polycythemia vera 2A20.4 Whole blood 1.05E-03 -8.63E-02 -6.13E-01
Pompe disease 5C51.3 Biceps muscle 9.72E-01 5.86E-02 2.81E-01
Preterm birth KA21.4Z Myometrium 1.61E-01 -4.87E-01 -9.39E-01
Prostate cancer 2C82 Prostate 1.20E-02 6.62E-01 9.63E-01
Psoriasis EA90 Skin 1.97E-07 2.36E-01 6.12E-01
Rectal cancer 2B92 Rectal colon tissue 8.77E-04 7.99E-01 2.40E+00
Renal cancer 2C90-2C91 Kidney 8.99E-01 -1.02E-01 -3.54E-01
Retinoblastoma 2D02.2 Uvea 5.36E-02 2.70E-01 1.03E+00
Rheumatoid arthritis FA20 Synovial tissue 6.80E-05 5.88E-01 2.58E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.45E-01 1.02E-02 4.73E-02
Schizophrenia 6A20 Prefrontal cortex 1.88E-01 3.79E-02 1.34E-01
Schizophrenia 6A20 Superior temporal cortex 3.02E-01 1.07E-01 4.47E-01
Scleroderma 4A42.Z Whole blood 1.73E-03 3.08E-01 1.62E+00
Seizure 8A60-8A6Z Whole blood 6.49E-01 -3.74E-02 -1.62E-01
Sensitive skin EK0Z Skin 9.13E-01 -2.15E-02 -9.62E-02
Sepsis with septic shock 1G41 Whole blood 3.03E-04 -7.00E-02 -2.21E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.25E-01 -9.65E-02 -6.24E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.73E-01 8.71E-02 4.15E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.71E-01 -9.19E-02 -1.20E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.25E-01 -1.74E-01 -2.10E+00
Skin cancer 2C30-2C3Z Skin 1.49E-06 1.52E-01 3.54E-01
Thrombocythemia 3B63 Whole blood 4.71E-02 -1.47E-01 -1.08E+00
Thrombocytopenia 3B64 Whole blood 6.54E-01 6.36E-01 5.93E-01
Thyroid cancer 2D10 Thyroid 1.84E-15 3.29E-01 1.01E+00
Tibial muscular dystrophy 8C75 Muscle tissue 5.52E-01 -9.39E-02 -1.75E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.61E-01 -7.75E-02 -1.46E+00
Type 2 diabetes 5A11 Liver tissue 4.41E-01 -1.35E-01 -5.44E-01
Ureter cancer 2C92 Urothelium 6.19E-01 6.83E-04 2.09E-03
Uterine cancer 2C78 Endometrium tissue 7.96E-06 -2.99E-01 -4.28E-01
Vitiligo ED63.0 Skin 6.75E-02 -1.58E-01 -1.06E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Nitric-oxide synthase endothelial (NOS3) DTT Info
DME DTT Type Clinical trial
6 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Tilarginine acetate DMZBGI8 Myocardial infarction BA41-BA43 Phase 3 [1]
ACCLAIM DM0FGDO Angina pectoris BA40 Phase 2 [2]
L-NAME DM01SR6 Hypertension BA00-BA04 Phase 2 [3]
MTR105 DMT0K4F Hypotension BA20-BA21 Phase 2 [4]
VAS-203 DMKU93J Brain injury NA07.Z Phase 2 [5]
Autologous cell based gene therapy DMQA1VT Pulmonary hypertension BB01 Phase 1 [6]
⏷ Show the Full List of 6 Clinical Trial Drug(s)
1 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-NIL DM6Y49D N. A. N. A. Terminated [7]
81 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(5-Imino-[1,4]thiazepan-3-yl)-methanol DMBKZDJ Discovery agent N.A. Investigative [8]
(5S,6R)-[Octahydro-quinolin-(2E)-ylidene]amine DMT9CXD Discovery agent N.A. Investigative [9]
(5S,6S)-[Octahydro-quinolin-(2E)-ylidene]amine DMP4UC1 Discovery agent N.A. Investigative [9]
(6r,1'r,2's)-5,6,7,8 Tetrahydrobiopterin DMOD9R7 Discovery agent N.A. Investigative [10]
(S)-2-Amino-5-(N-methyl-guanidino)-pentanoic acid DMZSWDM Discovery agent N.A. Investigative [11]
(S)-3-Propyl-[1,4]thiazepan-(5E)-ylideneamine DMIG9H3 Discovery agent N.A. Investigative [8]
(S)-6-Amino-2-(2-imino-ethylamino)-hexanoic acid DMG58HM Discovery agent N.A. Investigative [8]
1,2,4-Triazole-Carboxamidine DMOXLHT Discovery agent N.A. Investigative [10]
1-(2-amino-benzothiazol-5-yl)-2-ethyl-isothiourea DMAE8BF Discovery agent N.A. Investigative [12]
1-(2-amino-benzothiazol-6-yl)-2-ethyl-isothiourea DMCSHRL Discovery agent N.A. Investigative [12]
1400W DMLZT64 Discovery agent N.A. Investigative [13]
2,4-Diamino-6-Phenyl-5,6,7,8,-Tetrahydropteridine DMQPKWM Discovery agent N.A. Investigative [13]
2-amino-4-methylpyridine DM1OED2 Discovery agent N.A. Investigative [14]
2-Amino-5-(N-nitro-guanidino)-pentanoic acid DMDUZ2H Discovery agent N.A. Investigative [11]
2-Aminothiazoline DM9YCAH Discovery agent N.A. Investigative [10]
2-Methyl-2,4-Pentanediol DMD45CU Discovery agent N.A. Investigative [10]
2-Methyl-[1,4]thiazepan-(5E)-ylideneamine DMX1IC4 Discovery agent N.A. Investigative [8]
2-Propanol, Isopropanol DML5O0H Discovery agent N.A. Investigative [10]
3,4-Dimethyl-pyrrolidin-(2Z)-ylideneamine DMMO6QI Discovery agent N.A. Investigative [15]
3-Bromo-1H-indazole-7-carbonitrile DMZGWL2 Discovery agent N.A. Investigative [16]
3-bromo-7-nitro-1H-indazole DMM7DHB Discovery agent N.A. Investigative [10]
3-Ethyl-[1,4]thiazepan-(5E)-ylideneamine DMX2JKQ Discovery agent N.A. Investigative [8]
3-Methyl-pyrrolidin-(2Z)-ylideneamine DMHVUF8 Discovery agent N.A. Investigative [15]
3-Methyl-[1,4]thiazepan-(5E)-ylideneamine DMCOH46 Discovery agent N.A. Investigative [8]
4,5-Dimethyl-pyrrolidin-(2Z)-ylideneamine DMB9CJM Discovery agent N.A. Investigative [15]
4-Ethyl-5,6-dihydro-1H-pyridin-(2Z)-ylideneamine DMTM1VD Discovery agent N.A. Investigative [17]
4-Ethyl-5-methyl-pyrrolidin-(2Z)-ylideneamine DMOAQ1E Discovery agent N.A. Investigative [15]
4-Ethyl-pyrrolidin-(2Z)-ylideneamine DMYIWAH Discovery agent N.A. Investigative [15]
4-Methyl-3,6-dihydro-1H-pyridin-(2Z)-ylideneamine DM5FWYG Discovery agent N.A. Investigative [17]
4-Methyl-5,6-dihydro-1H-pyridin-(2Z)-ylideneamine DMUP8NS Discovery agent N.A. Investigative [17]
4-methyl-6-propylpyridin-2-amine DMY04D1 Discovery agent N.A. Investigative [14]
4-Methyl-piperidin-(2E)-ylideneamine DMNMXCE Discovery agent N.A. Investigative [9]
4-Methyl-pyrrolidin-(2Z)-ylideneamine DM0YS36 Discovery agent N.A. Investigative [15]
5,6-Cyclic-Tetrahydropteridine DMDE7XJ Discovery agent N.A. Investigative [18]
5-Ethyl-3-methyl-pyrrolidin-(2Z)-ylideneamine DMS9TFC Discovery agent N.A. Investigative [15]
5-Ethyl-4-methyl-pyrrolidin-(2Z)-ylideneamine DMQWOIG Discovery agent N.A. Investigative [15]
5-Methyl-pyrrolidin-(2Z)-ylideneamine DM4QB3G Discovery agent N.A. Investigative [15]
5-Nitroindazole DMH7SIX Discovery agent N.A. Investigative [10]
6-(2-Fluoropropyl)-4-methylpyridin-2-amine DME1JLM Discovery agent N.A. Investigative [19]
6-(3-Fluoropropyl)-4-methylpyridin-2-amine DMTJPZU Discovery agent N.A. Investigative [19]
6-isobutyl-4-methylpyridin-2-amine DM2XB68 Discovery agent N.A. Investigative [19]
6-Nitroindazole DM2WZCX Discovery agent N.A. Investigative [10]
6s-5,6,7,8-Tetrahydrobiopterin DMIA7ND Discovery agent N.A. Investigative [10]
7-(2-Nitro-ethyl)-azepan-(2Z)-ylideneamine DMK28IS Discovery agent N.A. Investigative [20]
7-Methyl-[1,4]thiazepan-(5E)-ylideneamine DMUCJA6 Discovery agent N.A. Investigative [8]
7-nitro-1H-indazole DMW4XKQ Discovery agent N.A. Investigative [10]
7-Nitroindazole-2-Carboxamidine DMGLWOM Discovery agent N.A. Investigative [13]
Acetate Ion DMD08RH Discovery agent N.A. Investigative [10]
AP-Cav DMT9Z5A Discovery agent N.A. Investigative [21]
Azepan-(2Z)-ylideneamine DMZHV39 Discovery agent N.A. Investigative [20]
Cacodylate Ion DMK4XLD Discovery agent N.A. Investigative [10]
Ethylisothiourea DMV9OCU N. A. N. A. Investigative [10]
Heme DMGC287 Discovery agent N.A. Investigative [13]
Hexahydro-cyclopenta[c]pyrrol-(1Z)-ylideneamine DMG0UVT Discovery agent N.A. Investigative [15]
Hydroxydimethylarsine Oxide DMPS2B1 Discovery agent N.A. Investigative [10]
L-2-Amino-4-(Guanidinooxy)Butyric Acid DMWQCRD Discovery agent N.A. Investigative [10]
L-Homoarginine DML83XP Discovery agent N.A. Investigative [10]
L-NIO DME9FAV Discovery agent N.A. Investigative [18]
N,N-dimethylarginine DM0Y8OW Discovery agent N.A. Investigative [22]
N-(5-Amino-6-oxo-heptyl)-acetamidine DM47XR8 Discovery agent N.A. Investigative [15]
N-(Chlorophenyl)-N'-Hydroxyguanidine DMFGSLO Discovery agent N.A. Investigative [13]
N-omega-allyl-L-arginine DM0BPCT Discovery agent N.A. Investigative [23]
N-Omega-Hydroxy-L-Arginine DMOXQ3N Discovery agent N.A. Investigative [10]
N-omega-propargyl-L-arginine DM9X3B7 Discovery agent N.A. Investigative [23]
N1,N14-Bis((S-Methyl)Isothioureido)Tetradecane DMVIGCJ Discovery agent N.A. Investigative [10]
N5-(1-iminobut-3-enyl)-L-ornithine DMB62OI Discovery agent N.A. Investigative [23]
N5-(1-iminobutyl)-L-ornithine DMT893N Discovery agent N.A. Investigative [23]
N5-(1-iminopropyl)-L-ornithine DM05O7J Discovery agent N.A. Investigative [23]
Nitroarginine DM7T80N N. A. N. A. Investigative [24]
Piperidin-(2E)-ylideneamine DMN8OR2 Discovery agent N.A. Investigative [9]
Pyrrolidin-(2Z)-ylideneamine DMS4ZFU Discovery agent N.A. Investigative [15]
S-(Dimethylarsenic)Cysteine DMSCHL0 Discovery agent N.A. Investigative [10]
S-Ethyl-N-Phenyl-Isothiourea DM6DT9Z Discovery agent N.A. Investigative [13]
S-Isopropyl-Isothiourea DMZ30AM Discovery agent N.A. Investigative [10]
Se-Ethyl-Isoselenourea DM9BJ27 Discovery agent N.A. Investigative [10]
THIOCITRULLINE DM7X8MH Discovery agent N.A. Investigative [25]
[1,3]Oxazinan-(2E)-ylideneamine DMDX6W4 Discovery agent N.A. Investigative [11]
[1,3]Thiazinan-(2E)-ylideneamine DMOEIHC Discovery agent N.A. Investigative [11]
[1,4]Oxazepan-(3E)-ylideneamine DMX58NK Discovery agent N.A. Investigative [8]
[1,4]Thiazepan-(3E)-ylideneamine DMCBFJQ Discovery agent N.A. Investigative [8]
[1,4]Thiazepan-(5E)-ylideneamine DMFQ0Z4 Discovery agent N.A. Investigative [8]
⏷ Show the Full List of 81 Investigative Drug(s)

References

1 Effect of tilarginine acetate in patients with acute myocardial infarction and cardiogenic shock: the TRIUMPH randomized controlled trial. JAMA. 2007 Apr 18;297(15):1657-66.
2 CenterWatch. Drugs in Clinical Trials Database. CenterWatch. 2008.
3 Counter-regulation by atorvastatin of gene modulations induced by L-NAME hypertension is associated with vascular protection. Vascul Pharmacol. 2009 Oct;51(4):253-61.
4 Nitric oxide synthase inhibitor (MTR-105) during open-heart surgery. A pilot double-blind placebo-controlled study of hemodynamic effects and safety. Cardiology. 2008;111(3):181-7.
5 Nitric oxide synthase inhibition with the antipterin VAS203 improves outcome in moderate and severe traumatic brain injury: a placebo-controlled randomized Phase IIa trial (NOSTRA). J Neurotrauma. 2014 Oct 1;31(19):1599-606.
6 Feasibility of using autologous transplantation to evaluate hematopoietic stem cell-based gene therapy strategies in transgenic mouse models of human disease. Mol Ther. 2002 Sep;6(3):422-8.
7 Discovery of a series of aminopiperidines as novel iNOS inhibitors. Bioorg Med Chem Lett. 2008 Jan 1;18(1):336-43.
8 Synthesis of analogs of (1,4)-3- and 5-imino oxazepane, thiazepane, and diazepane as inhibitors of nitric oxide synthases. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5907-11.
9 Bicyclic amidine inhibitors of nitric oxide synthase: discovery of perhydro-iminopyrindine and perhydro-iminoquinoline as potent, orally active inh... Bioorg Med Chem Lett. 2005 Apr 15;15(8):1997-2001.
10 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
11 2-Iminopiperidine and other 2-iminoazaheterocycles as potent inhibitors of human nitric oxide synthase isoforms. J Med Chem. 1996 Feb 2;39(3):669-72.
12 Novel 2-aminobenzothiazoles as selective neuronal nitric oxide synthase inhibitors. Bioorg Med Chem Lett. 2007 May 1;17(9):2540-4.
13 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
14 Anchored plasticity opens doors for selective inhibitor design in nitric oxide synthase. Nat Chem Biol. 2008 Nov;4(11):700-7.
15 Evaluation of pyrrolidin-2-imines and 1,3-thiazolidin-2-imines as inhibitors of nitric oxide synthase. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4539-44.
16 Inhibitory effects of a series of 7-substituted-indazoles toward nitric oxide synthases: particular potency of 1H-indazole-7-carbonitrile. Bioorg Med Chem. 2008 Jun 1;16(11):5962-73.
17 Design and synthesis of orally bioavailable inhibitors of inducible nitric oxide synthase. Part 1: synthesis and biological evaluation of dihydropy... Bioorg Med Chem Lett. 2002 Sep 2;12(17):2291-4.
18 DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
19 Design and synthesis of 2-amino-4-methylpyridine analogues as inhibitors for inducible nitric oxide synthase and in vivo evaluation of [18F]6-(2-fl... J Med Chem. 2009 Apr 23;52(8):2443-53.
20 Selective heterocyclic amidine inhibitors of human inducible nitric oxide synthase. Bioorg Med Chem Lett. 2001 Oct 8;11(19):2651-3.
21 Endothelial nitric oxide synthase: the Cinderella of inflammation Trends Pharmacol Sci. 2003 Feb;24(2):91-5.
22 Homocysteine and asymmetric dimethylarginine (ADMA): biochemically linked but differently related to vascular disease in chronic kidney disease. Clin Chem Lab Med. 2007;45(12):1683-7.
23 Structure-activity relationship of novel and known inhibitors of human dimethylarginine dimethylaminohydrolase-1: alkenyl-amidines as new leads. Bioorg Med Chem. 2008 Dec 15;16(24):10205-9.
24 Crystal structure of nitric oxide synthase bound to nitro indazole reveals a novel inactivation mechanism. Biochemistry. 2001 Nov 13;40(45):13448-55.
25 Evaluation of 3-substituted arginine analogs as selective inhibitors of human nitric oxide synthase isozymes. Bioorg Med Chem Lett. 2005 Jun 2;15(11):2881-5.
26 The role of nitric oxide in anthracycline toxicity and prospects for pharmacologic prevention of cardiac damage. FASEB J. 2004 Apr;18(6):664-75.