Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DER7TA0)

DME Name N-acetyltransferase 2 (NAT2)
Synonyms Arylamine N-acetyltransferase 2; N-acetyltransferase type 2; Arylamide acetylase 2; Polymorphic arylamine N-acetyltransferase; AAC2; NAT-2; NAT2; PNAT
Gene Name NAT2
UniProt ID
ARY2_HUMAN
INTEDE ID
DME0051
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
10
EC Number EC: 2.3.1.5
Transferase
Acyltransferase
Acyltransferase
EC: 2.3.1.5
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIV
RRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYI
VDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHL
LPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILT
YRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI
Function
This enzyme participates in the detoxification of a plethora of hydrazine and arylamine drugs. It catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
KEGG Pathway
Caffeine metabolism (hsa00232 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Acetylation (R-HSA-156582 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
5 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Amifampridine DMK08L3 LambertEaton myasthenic syndrome 8C62 Approved [1]
Aminosalicylic Acid DMENSL5 Crohn disease DD70 Approved [2]
Aspirin DM672AH Acute coronary syndrome BA41 Approved [3]
Hydralazine DMU8JGH Chronic heart failure BD1Z Approved [4]
Procainamide DMNMXR8 Ventricular arrhythmias BC71 Approved [5]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Asacolitin DM3WVPJ N. A. N. A. Investigative [6]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.96E-03 1.15E-02 5.63E-02
Alopecia ED70 Skin from scalp 3.53E-06 3.00E-01 1.09E+00
Alzheimer's disease 8A20 Entorhinal cortex 8.19E-01 6.63E-02 3.12E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.91E-01 7.19E-02 4.83E-01
Aortic stenosis BB70 Calcified aortic valve 7.81E-01 -1.99E-01 -2.69E-01
Apnea 7A40 Hyperplastic tonsil 1.71E-01 -1.50E-01 -6.78E-01
Arthropathy FA00-FA5Z Peripheral blood 4.08E-01 4.59E-02 2.34E-01
Asthma CA23 Nasal and bronchial airway 1.57E-01 -1.06E-02 -1.58E-02
Atopic dermatitis EA80 Skin 1.25E-01 3.38E-03 1.33E-02
Autism 6A02 Whole blood 7.04E-01 5.83E-03 3.15E-02
Autoimmune uveitis 9A96 Peripheral monocyte 4.98E-01 -8.52E-02 -7.23E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.87E-01 -7.49E-02 -4.64E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.43E-01 1.04E-03 2.64E-03
Batten disease 5C56.1 Whole blood 4.86E-02 1.16E-01 7.83E-01
Behcet's disease 4A62 Peripheral blood 4.17E-01 5.85E-02 2.88E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.46E-01 -9.36E-02 -5.34E-01
Bladder cancer 2C94 Bladder tissue 4.32E-04 6.56E-01 2.09E+00
Breast cancer 2C60-2C6Z Breast tissue 2.89E-01 -1.26E-01 -2.25E-01
Cardioembolic stroke 8B11.20 Whole blood 6.45E-01 -1.68E-02 -9.03E-02
Cervical cancer 2C77 Cervical tissue 1.34E-01 -7.62E-02 -3.03E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.57E-02 9.46E-02 5.65E-01
Chronic hepatitis C 1E51.1 Whole blood 4.69E-01 4.38E-02 2.22E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.30E-02 6.89E-02 2.65E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.92E-01 -3.84E-02 -1.61E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.25E-01 5.65E-02 3.30E-01
Colon cancer 2B90 Colon tissue 1.09E-124 -1.90E+00 -3.62E+00
Coronary artery disease BA80-BA8Z Peripheral blood 7.12E-01 2.60E-02 3.56E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.80E-01 9.43E-03 6.53E-02
Endometriosis GA10 Endometrium tissue 7.16E-01 1.45E-01 2.57E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.80E-02 -9.16E-02 -1.18E+00
Familial hypercholesterolemia 5C80.00 Whole blood 3.49E-01 -8.28E-02 -3.71E-01
Gastric cancer 2B72 Gastric tissue 4.24E-03 5.18E-01 2.82E+00
Glioblastopma 2A00.00 Nervous tissue 5.77E-05 8.09E-02 1.77E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.89E-01 5.66E-02 5.18E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.38E-01 -3.91E-02 -1.59E-01
Head and neck cancer 2D42 Head and neck tissue 1.83E-09 -1.50E-01 -6.21E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.99E-02 -3.76E-02 -9.80E-02
Huntington's disease 8A01.10 Whole blood 4.85E-01 -4.83E-02 -4.22E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.20E-01 9.90E-03 2.90E-02
Immunodeficiency 4A00-4A20 Peripheral blood 3.53E-01 -5.59E-02 -5.10E-01
Influenza 1E30 Whole blood 7.29E-02 2.58E-01 1.43E+00
Interstitial cystitis GC00.3 Bladder tissue 7.68E-01 7.81E-03 7.28E-02
Intracranial aneurysm 8B01.0 Intracranial artery 7.10E-02 1.74E-01 6.12E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.41E-01 -3.05E-03 -1.01E-02
Ischemic stroke 8B11 Peripheral blood 2.81E-01 1.13E-01 5.03E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.10E-01 2.48E-02 7.95E-02
Lateral sclerosis 8B60.4 Skin 1.24E-01 1.55E-01 1.42E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 5.74E-01 -3.52E-02 -2.31E-01
Liver cancer 2C12.0 Liver tissue 1.24E-34 -3.95E+00 -4.52E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.89E-04 -3.37E+00 -7.36E+00
Lung cancer 2C25 Lung tissue 6.30E-02 -1.16E-01 -4.12E-01
Lupus erythematosus 4A40 Whole blood 7.75E-01 -7.22E-02 -1.19E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.04E-01 -5.34E-03 -2.92E-02
Major depressive disorder 6A70-6A7Z Whole blood 9.99E-01 2.08E-02 7.40E-02
Melanoma 2C30 Skin 5.24E-01 -1.29E-01 -1.47E-01
Multiple myeloma 2A83.1 Peripheral blood 1.07E-01 2.25E-01 1.27E+00
Multiple myeloma 2A83.1 Bone marrow 3.80E-03 -3.26E-01 -1.30E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.19E-01 1.04E-01 4.05E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.13E-01 5.34E-02 2.12E-01
Myelofibrosis 2A20.2 Whole blood 2.41E-01 -8.68E-02 -5.49E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.98E-01 4.58E-02 7.00E-02
Myopathy 8C70.6 Muscle tissue 1.95E-01 -8.47E-02 -4.80E-01
Neonatal sepsis KA60 Whole blood 8.44E-02 1.75E-02 7.48E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.03E-05 -9.04E-01 -2.81E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.22E-03 -5.91E-01 -2.01E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.55E-01 1.04E-01 9.82E-01
Olive pollen allergy CA08.00 Peripheral blood 3.64E-01 5.60E-03 2.41E-02
Oral cancer 2B6E Oral tissue 9.62E-04 -4.81E-01 -1.15E+00
Osteoarthritis FA00-FA0Z Synovial tissue 7.78E-01 -1.31E-02 -3.19E-02
Osteoporosis FB83.1 Bone marrow 6.56E-02 2.91E-01 1.35E+00
Ovarian cancer 2C73 Ovarian tissue 9.87E-01 -3.06E-02 -1.01E-01
Pancreatic cancer 2C10 Pancreas 5.46E-01 -2.97E-01 -6.71E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.86E-01 5.97E-02 2.31E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.43E-01 1.58E-02 8.44E-02
Pituitary cancer 2D12 Pituitary tissue 2.64E-02 1.38E-01 4.59E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.60E-02 1.30E-01 5.36E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.89E-01 -4.93E-02 -1.44E-01
Polycythemia vera 2A20.4 Whole blood 5.20E-02 3.53E-02 1.94E-01
Pompe disease 5C51.3 Biceps muscle 8.11E-01 -1.34E-01 -7.63E-01
Preterm birth KA21.4Z Myometrium 5.60E-01 -1.40E-01 -6.77E-01
Prostate cancer 2C82 Prostate 1.22E-03 -8.68E-01 -1.19E+00
Psoriasis EA90 Skin 7.77E-14 -2.86E-01 -6.87E-01
Rectal cancer 2B92 Rectal colon tissue 1.27E-04 -1.50E+00 -3.00E+00
Renal cancer 2C90-2C91 Kidney 1.33E-05 -8.37E-01 -2.34E+00
Retinoblastoma 2D02.2 Uvea 8.25E-03 -2.99E-01 -1.43E+00
Rheumatoid arthritis FA20 Synovial tissue 3.53E-01 -2.97E-01 -6.91E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.57E-01 -2.11E-02 -1.36E-01
Schizophrenia 6A20 Prefrontal cortex 8.46E-01 3.08E-03 6.89E-03
Schizophrenia 6A20 Superior temporal cortex 3.95E-01 -8.08E-02 -4.19E-01
Scleroderma 4A42.Z Whole blood 7.70E-04 2.34E-01 1.70E+00
Seizure 8A60-8A6Z Whole blood 2.71E-01 -1.11E-01 -5.45E-01
Sensitive skin EK0Z Skin 4.92E-01 -3.39E-01 -1.79E+00
Sepsis with septic shock 1G41 Whole blood 7.59E-06 9.10E-03 3.40E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.52E-01 1.96E-01 6.17E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.50E-01 2.06E-01 9.02E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.54E-01 -3.46E-01 -1.62E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.48E-01 -1.76E-01 -8.82E-01
Skin cancer 2C30-2C3Z Skin 1.43E-03 -9.16E-02 -1.89E-01
Thrombocythemia 3B63 Whole blood 5.87E-01 7.33E-03 4.52E-02
Thrombocytopenia 3B64 Whole blood 3.16E-01 2.98E-02 2.08E-01
Thyroid cancer 2D10 Thyroid 2.53E-03 5.07E-02 1.64E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.16E-01 1.08E-02 4.06E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.49E-01 1.27E-01 8.03E-01
Type 2 diabetes 5A11 Liver tissue 1.95E-01 4.03E-01 1.04E+00
Ureter cancer 2C92 Urothelium 2.90E-01 -1.49E-01 -6.06E-01
Uterine cancer 2C78 Endometrium tissue 1.35E-09 -3.28E-01 -8.40E-01
Vitiligo ED63.0 Skin 7.40E-01 -2.39E-02 -7.48E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Genetic variation in aryl N-acetyltransferase results in significant differences in the pharmacokinetic and safety profiles of amifampridine (3,4-diaminopyridine) phosphate. Pharmacol Res Perspect. 2015 Feb;3(1):e00099.
2 Importance of the evaluation of N-acetyltransferase enzyme activity prior to 5-aminosalicylic acid medication for ulcerative colitis. Inflamm Bowel Dis. 2016 Aug;22(8):1793-802.
3 Polymorphisms of Aspirin-Metabolizing Enzymes CYP2C9, NAT2 and UGT1A6 in Aspirin-Intolerant Urticaria. Allergy Asthma Immunol Res. 2011 Oct;3(4):273-6.
4 N-acetyltransferase 2 genotype-dependent N-acetylation of hydralazine in human hepatocytes. Drug Metab Dispos. 2017 Dec;45(12):1276-1281.
5 Substrate-dependent regulation of human arylamine N-acetyltransferase-1 in cultured cells. Mol Pharmacol. 2000 Mar;57(3):468-73.
6 Identification and functional characterization of arylamine N-acetyltransferases in eubacteria: evidence for highly selective acetylation of 5-aminosalicylic acid. J Bacteriol. 2001 Jun;183(11):3417-27.