Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEV3T4A)

DME Name Catechol O-methyltransferase (COMT)
Synonyms Catecholamine degradation enzyme; Catecholestrogen degradation enzyme; COMT; HEL-S-98n
Gene Name COMT
UniProt ID
COMT_HUMAN
INTEDE ID
DME0043
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1312
EC Number EC: 2.1.1.6
Transferase
Methylase
Methyltransferase
EC: 2.1.1.6
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE
CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Function
This enzyme catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. It also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
KEGG Pathway
Dopaminergic synapse (hsa04728 )
Metabolic pathways (hsa01100 )
Steroid hormone biosynthesis (hsa00140 )
Tyrosine metabolism (hsa00350 )
Reactome Pathway
Enzymatic degradation of dopamine by COMT (R-HSA-379397 )
Methylation (R-HSA-156581 )
Enzymatic degradation of Dopamine by monoamine oxidase (R-HSA-379398 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
3 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dobutamine DMD1B8Z Heart failure BD10-BD13 Approved [1]
Dopamine DMPGUCF Acromegaly 5A60.0 Approved [2]
Epinephrine DM3KJBC Acute asthma CA23 Approved [3]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
METHYLENEDIOXYMETHAMPHETAMINE DMYVU47 Discovery agent N.A. Investigative [4]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.56E-52 6.77E-01 2.52E+00
Alopecia ED70 Skin from scalp 1.05E-01 -8.93E-02 -2.59E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.00E-03 9.63E-02 4.48E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.25E-01 -1.90E-02 -9.88E-02
Aortic stenosis BB70 Calcified aortic valve 9.33E-01 -1.93E-02 -5.56E-02
Apnea 7A40 Hyperplastic tonsil 1.15E-01 -1.80E-01 -5.35E-01
Arthropathy FA00-FA5Z Peripheral blood 7.19E-01 -3.17E-02 -2.59E-01
Asthma CA23 Nasal and bronchial airway 1.66E-03 -9.86E-03 -1.48E-02
Atopic dermatitis EA80 Skin 2.52E-01 4.58E-02 1.61E-01
Autism 6A02 Whole blood 8.73E-01 5.66E-03 2.54E-02
Autoimmune uveitis 9A96 Peripheral monocyte 9.39E-02 -5.07E-01 -1.40E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.52E-01 -1.79E-02 -6.27E-02
Bacterial infection of gingival 1C1H Gingival tissue 2.37E-01 6.37E-02 2.36E-01
Batten disease 5C56.1 Whole blood 3.49E-01 5.55E-02 3.12E-01
Behcet's disease 4A62 Peripheral blood 5.34E-01 1.35E-01 5.13E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.70E-01 -2.74E-02 -1.75E-01
Bladder cancer 2C94 Bladder tissue 3.31E-01 3.45E-03 1.92E-02
Breast cancer 2C60-2C6Z Breast tissue 2.76E-14 -2.05E-01 -5.59E-01
Cardioembolic stroke 8B11.20 Whole blood 1.55E-07 -3.33E-01 -2.09E+00
Cervical cancer 2C77 Cervical tissue 5.81E-02 -1.50E-01 -4.91E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.54E-01 1.16E-01 2.99E-01
Chronic hepatitis C 1E51.1 Whole blood 2.95E-01 3.38E-02 1.70E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.98E-01 -6.93E-02 -2.47E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.20E-01 2.55E-03 1.11E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.13E-01 -6.12E-02 -2.79E-01
Colon cancer 2B90 Colon tissue 1.42E-18 2.36E-01 9.85E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.47E-01 3.38E-01 9.38E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.25E-01 -6.20E-02 -3.04E-01
Endometriosis GA10 Endometrium tissue 3.16E-01 1.66E-01 4.19E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.54E-01 2.04E-02 1.32E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.76E-09 6.92E-01 1.92E+00
Gastric cancer 2B72 Gastric tissue 3.16E-01 -1.23E-01 -1.00E+00
Glioblastopma 2A00.00 Nervous tissue 1.12E-10 1.41E-01 4.21E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.60E-01 -5.65E-02 -2.16E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.93E-04 4.66E-01 1.44E+00
Head and neck cancer 2D42 Head and neck tissue 9.70E-02 8.17E-02 2.86E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.43E-01 2.94E-02 1.42E-01
Huntington's disease 8A01.10 Whole blood 4.19E-01 -4.26E-02 -1.44E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.57E-01 9.15E-02 4.41E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.75E-01 4.17E-02 5.73E-01
Influenza 1E30 Whole blood 6.10E-02 1.65E-01 1.95E+00
Interstitial cystitis GC00.3 Bladder tissue 4.72E-03 -5.64E-01 -2.51E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.01E-02 4.09E-01 1.32E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.23E-02 -2.35E-01 -6.35E-01
Ischemic stroke 8B11 Peripheral blood 2.37E-01 -1.05E-01 -5.95E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.27E-04 -3.32E-01 -8.63E-01
Lateral sclerosis 8B60.4 Skin 6.98E-01 -2.39E-02 -1.14E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.27E-01 -6.40E-02 -2.84E-01
Liver cancer 2C12.0 Liver tissue 1.46E-09 -7.19E-01 -1.41E+00
Liver failure DB99.7-DB99.8 Liver tissue 7.15E-01 8.01E-03 2.57E-02
Lung cancer 2C25 Lung tissue 5.91E-55 -4.80E-01 -1.87E+00
Lupus erythematosus 4A40 Whole blood 1.04E-01 -9.87E-02 -3.94E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.34E-01 -7.97E-02 -5.31E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.90E-01 -3.81E-02 -1.21E-01
Melanoma 2C30 Skin 7.68E-02 -2.81E-01 -4.39E-01
Multiple myeloma 2A83.1 Peripheral blood 7.05E-01 -1.75E-01 -4.72E-01
Multiple myeloma 2A83.1 Bone marrow 2.67E-01 1.11E-01 6.63E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.53E-01 -5.26E-02 -2.33E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.37E-01 1.61E-01 3.82E-01
Myelofibrosis 2A20.2 Whole blood 1.43E-03 -9.00E-02 -7.70E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.10E-01 6.42E-02 2.34E-01
Myopathy 8C70.6 Muscle tissue 1.11E-02 1.95E-01 1.31E+00
Neonatal sepsis KA60 Whole blood 1.60E-05 1.48E-01 5.71E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.89E-07 -9.23E-01 -3.71E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.83E-01 1.58E-01 3.06E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.72E-01 2.09E-01 8.78E-01
Olive pollen allergy CA08.00 Peripheral blood 4.45E-03 2.76E-01 2.11E+00
Oral cancer 2B6E Oral tissue 1.85E-03 -2.24E-01 -5.92E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.54E-01 2.94E-01 3.05E-01
Osteoporosis FB83.1 Bone marrow 3.49E-02 3.98E-01 1.58E+00
Ovarian cancer 2C73 Ovarian tissue 1.37E-02 -2.67E-01 -9.61E-01
Pancreatic cancer 2C10 Pancreas 4.28E-04 1.55E-01 9.30E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.24E-02 1.66E-01 1.09E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.72E-03 1.52E-01 1.03E+00
Pituitary cancer 2D12 Pituitary tissue 2.97E-04 3.20E-01 1.71E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.14E-03 3.64E-01 1.66E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.90E-01 5.54E-02 3.90E-01
Polycythemia vera 2A20.4 Whole blood 1.46E-04 -1.08E-01 -7.18E-01
Pompe disease 5C51.3 Biceps muscle 8.67E-01 -7.96E-02 -3.64E-01
Preterm birth KA21.4Z Myometrium 5.89E-01 1.16E-01 3.11E-01
Prostate cancer 2C82 Prostate 9.18E-05 -6.21E-01 -1.16E+00
Psoriasis EA90 Skin 1.68E-08 -1.23E-01 -4.31E-01
Rectal cancer 2B92 Rectal colon tissue 7.79E-01 -2.64E-02 -8.37E-02
Renal cancer 2C90-2C91 Kidney 6.24E-03 -4.31E-01 -1.20E+00
Retinoblastoma 2D02.2 Uvea 1.89E-03 7.71E-01 3.60E+00
Rheumatoid arthritis FA20 Synovial tissue 5.35E-07 1.16E+00 5.81E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.11E-01 3.63E-02 2.64E-01
Schizophrenia 6A20 Prefrontal cortex 1.82E-01 3.02E-02 1.12E-01
Schizophrenia 6A20 Superior temporal cortex 1.25E-01 -4.21E-02 -2.89E-01
Scleroderma 4A42.Z Whole blood 8.75E-01 -2.69E-02 -2.49E-01
Seizure 8A60-8A6Z Whole blood 4.90E-01 -1.89E-02 -1.45E-01
Sensitive skin EK0Z Skin 8.05E-01 -4.37E-02 -3.55E-01
Sepsis with septic shock 1G41 Whole blood 8.27E-05 4.70E-02 2.38E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.92E-02 -2.47E-01 -1.82E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.19E-01 1.90E-01 7.36E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.20E-01 1.06E-01 2.79E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.48E-01 -8.53E-02 -3.72E-01
Skin cancer 2C30-2C3Z Skin 2.16E-17 -3.72E-01 -1.02E+00
Thrombocythemia 3B63 Whole blood 8.08E-02 -1.34E-01 -1.10E+00
Thrombocytopenia 3B64 Whole blood 4.43E-01 4.48E-01 4.47E-01
Thyroid cancer 2D10 Thyroid 1.91E-02 2.97E-02 1.05E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.11E-01 -8.22E-02 -2.97E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.55E-01 3.93E-01 2.35E+00
Type 2 diabetes 5A11 Liver tissue 9.27E-01 6.45E-02 2.23E-01
Ureter cancer 2C92 Urothelium 7.95E-01 4.61E-02 1.85E-01
Uterine cancer 2C78 Endometrium tissue 3.79E-09 -1.79E-01 -4.03E-01
Vitiligo ED63.0 Skin 6.75E-03 9.15E-02 1.14E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name HUMAN catechol-O-methyl-transferase (COMT) DTT Info

References

1 Catechol-O-methyltransferase: substrate-specificity and stereoselectivity for beta-adrenoceptor agents. Xenobiotica. 1986 Jan;16(1):47-52.
2 Association between polymorphisms in catechol-O-methyltransferase (COMT) and cocaine-induced paranoia in European-American and African-American populations. Am J Med Genet B Neuropsychiatr Genet. 2011 Sep;156B(6):651-60.
3 Different metabolism of norepinephrine and epinephrine by catechol-O-methyltransferase and monoamine oxidase in rats. J Pharmacol Exp Ther. 1994 Mar;268(3):1242-51.
4 Human pharmacology of MDMA: pharmacokinetics, metabolism, and disposition. Ther Drug Monit. 2004 Apr;26(2):137-44.