Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEVRYQN)

DME Name Vitamin K1 2,3-epoxide reductase 1 (VKOR)
Synonyms Vitamin K epoxide reductase complex subunit 1; Vitamin K1 2,3-epoxide reductase subunit 1; MSTP134; MSTP576; UNQ308/PRO351; VKOR; VKORC1
Gene Name VKORC1
UniProt ID
VKOR1_HUMAN
INTEDE ID
DME0149
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
79001
EC Number EC: 1.17.4.4
Oxidoreductase
CH/CH2 oxidoreductase
Disulfide acceptor oxidoreductase
EC: 1.17.4.4
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG
RGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYL
AWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH
Function This enzyme is involved in vitamin K metabolism. Its catalytic subunit of the vitamin K epoxide reductase (VKOR) complex which reduces inactive vitamin K 2,3-epoxide to active vitamin K.
KEGG Pathway
Metabolic pathways (hsa01100 )
Ubiquinone and other terpenoid-quinone biosynthesis (hsa00130 )
Reactome Pathway
Metabolism of vitamin K (R-HSA-6806664 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Menadiol sodium diphosphate DMP9N85 Coagulation defect 3B10.0 Approved [5]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vitamin K DMN6EZY Discovery agent N.A. Investigative [6]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.26E-07 3.07E-01 6.07E-01
Alopecia ED70 Skin from scalp 4.07E-01 5.45E-03 2.08E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.57E-01 -5.96E-02 -2.56E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.18E-02 2.90E-01 1.18E+00
Aortic stenosis BB70 Calcified aortic valve 7.32E-01 8.97E-02 6.06E-02
Apnea 7A40 Hyperplastic tonsil 4.49E-01 -1.28E-01 -3.13E-01
Arthropathy FA00-FA5Z Peripheral blood 3.95E-02 -2.01E-01 -1.22E+00
Asthma CA23 Nasal and bronchial airway 1.46E-01 1.26E-01 1.25E-01
Atopic dermatitis EA80 Skin 1.57E-01 9.97E-02 4.34E-01
Autism 6A02 Whole blood 3.20E-02 -2.07E-01 -4.96E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.64E-01 -1.95E-01 -4.88E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.36E-01 -3.60E-01 -8.85E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.22E-16 4.54E-01 1.37E+00
Batten disease 5C56.1 Whole blood 4.53E-01 -7.58E-02 -3.16E-01
Behcet's disease 4A62 Peripheral blood 7.61E-01 3.56E-02 1.22E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.57E-01 1.58E-02 9.36E-02
Bladder cancer 2C94 Bladder tissue 1.14E-01 -2.30E-01 -1.03E+00
Breast cancer 2C60-2C6Z Breast tissue 1.55E-25 3.70E-01 8.53E-01
Cardioembolic stroke 8B11.20 Whole blood 2.04E-05 3.29E-01 1.51E+00
Cervical cancer 2C77 Cervical tissue 7.80E-02 1.87E-01 5.00E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.43E-01 4.80E-02 1.83E-01
Chronic hepatitis C 1E51.1 Whole blood 1.93E-01 -1.12E-01 -6.52E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.12E-01 -1.72E-01 -4.44E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.58E-01 3.99E-02 1.09E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.53E-01 1.50E-01 2.92E-01
Colon cancer 2B90 Colon tissue 2.52E-28 3.87E-01 1.13E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.48E-03 5.88E-01 2.64E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.33E-01 -1.42E-01 -3.24E-01
Endometriosis GA10 Endometrium tissue 4.95E-01 1.39E-01 2.26E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.18E-01 5.09E-02 2.72E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.11E-08 6.64E-01 1.75E+00
Gastric cancer 2B72 Gastric tissue 6.90E-01 6.27E-02 1.26E-01
Glioblastopma 2A00.00 Nervous tissue 1.10E-50 4.38E-01 1.13E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.17E-01 8.51E-02 2.66E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.83E-04 1.25E+00 1.88E+00
Head and neck cancer 2D42 Head and neck tissue 5.26E-40 8.18E-01 2.40E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.87E-01 8.49E-02 3.29E-01
Huntington's disease 8A01.10 Whole blood 5.92E-01 -1.13E-02 -2.64E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.25E-05 3.28E-01 3.86E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.63E-01 -2.48E-02 -1.52E-01
Influenza 1E30 Whole blood 4.98E-02 -2.92E-01 -2.12E+00
Interstitial cystitis GC00.3 Bladder tissue 6.93E-01 4.16E-02 1.58E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.45E-05 6.11E-01 1.87E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.39E-01 -1.07E-01 -2.45E-01
Ischemic stroke 8B11 Peripheral blood 6.63E-02 -2.33E-01 -1.27E+00
Juvenile idiopathic arthritis FA24 Peripheral blood 3.68E-03 -2.16E-01 -5.00E-01
Lateral sclerosis 8B60.4 Skin 7.37E-01 -1.06E-01 -4.25E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.10E-01 -4.96E-01 -6.28E-01
Liver cancer 2C12.0 Liver tissue 5.23E-14 -6.86E-01 -1.39E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.82E-04 -1.29E+00 -2.22E+00
Lung cancer 2C25 Lung tissue 8.98E-24 2.75E-01 9.20E-01
Lupus erythematosus 4A40 Whole blood 1.98E-02 -1.22E-01 -2.23E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.09E-01 -1.76E-02 -1.06E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.16E-01 -1.59E-01 -4.05E-01
Melanoma 2C30 Skin 8.68E-02 6.26E-01 5.80E-01
Multiple myeloma 2A83.1 Peripheral blood 7.51E-01 -9.92E-02 -1.38E-01
Multiple myeloma 2A83.1 Bone marrow 1.56E-03 7.87E-01 1.67E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.41E-01 -3.62E-01 -6.10E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.39E-01 9.39E-02 2.38E-01
Myelofibrosis 2A20.2 Whole blood 6.39E-01 1.14E-01 5.98E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.96E-03 -2.09E-01 -4.09E-01
Myopathy 8C70.6 Muscle tissue 3.76E-03 3.21E-01 1.47E+00
Neonatal sepsis KA60 Whole blood 7.23E-02 9.87E-02 3.41E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.65E-04 6.66E-01 1.70E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.13E-01 -2.65E-01 -5.92E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.71E-01 2.50E-02 8.43E-02
Olive pollen allergy CA08.00 Peripheral blood 1.95E-01 8.10E-01 6.48E-01
Oral cancer 2B6E Oral tissue 4.87E-02 4.85E-01 7.62E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.97E-01 1.34E+00 6.41E-01
Osteoporosis FB83.1 Bone marrow 2.40E-01 8.63E-02 3.24E-01
Ovarian cancer 2C73 Ovarian tissue 4.47E-01 1.94E-01 4.55E-01
Pancreatic cancer 2C10 Pancreas 6.28E-01 1.48E-01 3.78E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.75E-01 -4.65E-02 -1.93E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.74E-02 1.40E-01 8.35E-01
Pituitary cancer 2D12 Pituitary tissue 4.28E-05 4.89E-01 2.17E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.31E-04 4.43E-01 1.89E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.68E-01 -3.21E-02 -2.46E-01
Polycythemia vera 2A20.4 Whole blood 1.69E-03 -1.19E-01 -5.84E-01
Pompe disease 5C51.3 Biceps muscle 1.88E-04 3.63E-01 2.48E+00
Preterm birth KA21.4Z Myometrium 5.08E-01 -1.74E-01 -5.99E-01
Prostate cancer 2C82 Prostate 1.16E-10 -1.05E+00 -2.35E+00
Psoriasis EA90 Skin 4.97E-07 -1.39E-01 -2.90E-01
Rectal cancer 2B92 Rectal colon tissue 6.88E-01 -8.17E-02 -3.37E-01
Renal cancer 2C90-2C91 Kidney 3.15E-04 3.61E-01 1.30E+00
Retinoblastoma 2D02.2 Uvea 1.83E-09 1.12E+00 3.96E+00
Rheumatoid arthritis FA20 Synovial tissue 9.88E-05 2.81E+00 3.54E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.38E-01 6.70E-03 5.01E-02
Schizophrenia 6A20 Prefrontal cortex 3.67E-01 6.90E-02 1.52E-01
Schizophrenia 6A20 Superior temporal cortex 5.83E-01 -6.05E-02 -4.97E-01
Scleroderma 4A42.Z Whole blood 2.24E-03 -2.44E-01 -1.76E+00
Seizure 8A60-8A6Z Whole blood 6.42E-01 1.66E-01 6.64E-01
Sensitive skin EK0Z Skin 6.95E-01 -4.36E-02 -2.73E-01
Sepsis with septic shock 1G41 Whole blood 2.42E-02 3.26E-02 1.15E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.07E-04 -7.47E-01 -2.69E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.68E-03 1.30E+00 1.52E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 1.19E-01 5.11E-01 1.44E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.05E-02 -5.19E-01 -1.07E+00
Skin cancer 2C30-2C3Z Skin 4.01E-01 1.65E-01 2.80E-01
Thrombocythemia 3B63 Whole blood 3.12E-01 -5.09E-02 -2.51E-01
Thrombocytopenia 3B64 Whole blood 7.53E-01 5.32E-01 6.02E-01
Thyroid cancer 2D10 Thyroid 1.17E-01 -1.40E-01 -5.30E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.71E-07 8.76E-01 2.06E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.00E-01 8.64E-02 6.43E-01
Type 2 diabetes 5A11 Liver tissue 1.25E-01 1.95E-01 1.45E+00
Ureter cancer 2C92 Urothelium 7.41E-01 1.02E-01 4.19E-01
Uterine cancer 2C78 Endometrium tissue 1.84E-24 -6.98E-01 -8.86E-01
Vitiligo ED63.0 Skin 5.19E-01 -6.50E-02 -1.88E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Vitamin K epoxide reductase complex 1 (VKORC1) DTT Info
DME DTT Type Successful
5 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Acenocoumarol DMH75KV Thrombosis DB61-GB90 Approved [1]
Dicumarol DMFQCB1 Bleeding disorder GA20-GA21 Approved [2]
Phenindione DM2PYNR Coagulation defect 3B10.0 Approved [3]
Phenprocoumon DMDO279 Myocardial infarction BA41-BA43 Approved [3]
Warfarin DMJYCVW Atrial fibrillation BC81.3 Approved [3]
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Tecarfarin DMTCR2O Cerebrovascular ischaemia 8B1Z Phase 3 [4]

References

1 Evaluation of a reverse-hybridization StripAssay for the detection of genetic polymorphisms leading to acenocoumarol sensitivity. Mol Biol Rep. 2010 Apr;37(4):1693-7.
2 Vitamin K antagonism of coumarin intoxication in the rat. Thromb Haemost. 1986 Apr 30;55(2):235-9.
3 [Oral anticoagulation and pharmacogenetics: importance in the clinical setting]. Rev Med Suisse. 2007 Sep 12;3(124):2030, 2033-4, 2036.
4 Tecarfarin, a novel vitamin K reductase antagonist, is not affected by CYP2C9 and CYP3A4 inhibition following concomitant administration of fluconazole in healthy participants. J Clin Pharmacol. 2011Apr;51(4):561-74.
5 SMPDB database: Vitamin K Metabolism
6 VKORC1L1, an enzyme mediating the effect of vitamin K in liver and extrahepatic tissues. Nutrients. 2018 Jul 26;10(8). pii: E970.