Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTEUC8H)
DTT Name | Vitamin K epoxide reductase complex 1 (VKORC1) | ||||
---|---|---|---|---|---|
Synonyms | Vitamin K1 2,3-epoxide reductase subunit 1; VKORC1; VKOR; UNQ308/PRO351; MSTP576; MSTP134 | ||||
Gene Name | VKORC1 | ||||
DTT Type |
Successful target
|
[1] | |||
BioChemical Class |
Short-chain dehydrogenases reductase
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
EC Number |
EC 1.17.4.4
|
||||
Sequence |
MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG
RGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYL AWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH |
||||
Function |
Involved invitamin K metabolism. Catalytic subunit of the vitamin K epoxide reductase (VKOR) complex which reduces inactive vitamin K 2,3-epoxide to active vitamin K. Vitamin K is required for the gamma-carboxylation of various proteins, including clotting factors, and is required for normal blood coagulation, but also for normal bone development.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||
BioCyc Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
5 Approved Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
The Drug-Metabolizing Enzyme (DME) Role of This DTT
DTT DME Name | Vitamin K1 2,3-epoxide reductase 1 (VKOR) | |||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Name | VKORC1 | |||||||||||||||||||||||||||
1 Approved Drug(s) Metabolized by This DTT
|
||||||||||||||||||||||||||||
1 Investigative Drug(s) Metabolized by This DTT
|
||||||||||||||||||||||||||||
References