General Information of Drug Off-Target (DOT) (ID: OT0LZOPP)

DOT Name CD164 sialomucin-like 2 protein (CD164L2)
Gene Name CD164L2
Related Disease
Essential hypertension ( )
High blood pressure ( )
UniProt ID
C16L2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05283
Sequence
MEAPGPRALRTALCGGCCCLLLCAQLAVAGKGARGFGRGALIRLNIWPAVQGACKQLEVC
EHCVEGDGARNLSSCVWEQCRPEEPGHCVAQSEVVKEGCSIYNRSEACPAAHHHPTYEPK
TVTTGSPPVPEAHSPGFDGASFIGGVVLVLSLQAVAFFVLHFLKAKDSTYQTLI

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Essential hypertension DIS7WI98 Strong Genetic Variation [1]
High blood pressure DISY2OHH Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of CD164 sialomucin-like 2 protein (CD164L2). [2]
Decitabine DMQL8XJ Approved Decitabine decreases the methylation of CD164 sialomucin-like 2 protein (CD164L2). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of CD164 sialomucin-like 2 protein (CD164L2). [4]
------------------------------------------------------------------------------------

References

1 A common genetic variant of FCN3/CD164L2 is associated with essential hypertension in a Chinese population.Clin Exp Hypertens. 2012;34(5):377-82. doi: 10.3109/10641963.2012.665538. Epub 2012 Apr 3.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.