Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0PG9GU)

• DOT Name: Interleukin-17 receptor E-like protein (IL17REL)
• Synonyms: IL-17 receptor E-like; IL-17RE-like
• Gene Name: IL17REL
• Related Disease:
  Inflammatory bowel disease
  Multiple sclerosis
  Non-insulin dependent diabetes
  Ulcerative colitis
• UniProt ID: I17EL_HUMAN
• Pfam ID: PF15037
• Sequence:
  MLAGQALAFLGLTWGTFQSLAIPRITECGLSCSQGFACRSHRNRNIFNSFCRPRPVSMSR
  SVLEALTSSTAMQCVPSDGCAMLLRVRASITLHERLRGLEACAMSLDTQETQCQSVWVAR
  ASHRQQGGQQLQVHFGCFAVSVAQHLYVTLRTIPHFCGVQLDQRHLVEDCGEEDVGRSVP
  DCLAGKLSYWVDRRRKAILVQVPRASGSPDYYLRLCLKRFTCEDAGAPVRVTANSVSQAV
  FLPYSQELPCLCLEGWSATPDAVRIQICPFENDTEALEVLWDTVYYHPESQTLSWEPACP
  VSGHVSLCWRPGPGAGCRKLQQSSQLVHRRVQYPLVDTQPQLCLKFSTSWGSWVRCPFEQ
  RRFPTWKMTIQPSPTKGHLRVTFFSSSPAHFQVHLCHRRKSQLPACQRTLQASPLPSASG
  DLAAAPAFAFLDLPREEACAPGICIQGWRTDVHFSVPQQLCNLRSSGCPSLRGRRRPRTR
  PRPPTAGWAWRALNRRLGGGNGETIRP

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[1]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[2]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[3]
Ulcerative colitis	DIS8K27O	moderate	Genetic Variation	[4]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Interleukin-17 receptor E-like protein (IL17REL).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Interleukin-17 receptor E-like protein (IL17REL).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Interleukin-17 receptor E-like protein (IL17REL).	[8]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin affects the expression of Interleukin-17 receptor E-like protein (IL17REL).	[6]

References

• [1] Whole-exome Sequence Analysis Implicates Rare Il17REL Variants in Familial and Sporadic Inflammatory Bowel Disease.Inflamm Bowel Dis. 2016 Jan;22(1):20-7. doi: 10.1097/MIB.0000000000000610.
• [2] Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.Ann Neurol. 2011 Dec;70(6):897-912. doi: 10.1002/ana.22609.
• [3] An Expanded Genome-Wide Association Study of Type 2 Diabetes in Europeans.Diabetes. 2017 Nov;66(11):2888-2902. doi: 10.2337/db16-1253. Epub 2017 May 31.
• [4] Deep Resequencing of Ulcerative Colitis-Associated Genes Identifies Novel Variants in Candidate Genes in the Korean Population.Inflamm Bowel Dis. 2018 Jul 12;24(8):1706-1717. doi: 10.1093/ibd/izy122.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Molecular characterization of a toxicological tipping point during human stem cell differentiation. Reprod Toxicol. 2020 Jan;91:1-13. doi: 10.1016/j.reprotox.2019.10.001. Epub 2019 Oct 7.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.