Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1033B9)

• DOT Name: Sperm protein associated with the nucleus on the X chromosome C (SPANXC)
• Synonyms: Cancer/testis antigen 11.3; CT11.3; Cancer/testis-associated protein CTp11; Nuclear-associated protein SPAN-Xc; SPANX-C; SPANX family member C
• Gene Name: SPANXC
• Related Disease:
  Hepatocellular carcinoma
  Lung adenocarcinoma
  Uveal Melanoma
  Melanoma
  Testicular cancer
• UniProt ID: SPNXC_HUMAN
• Pfam ID: PF07458
• Sequence:
  MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPKKLKTSESSTILVVRYRRNVK
  RTSPEELVNDHARENRINPLQMEEEEFMEIMVEIPAK
• Tissue Specificity: Detected in testis, melanoma and bladder carcinoma.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[1]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[2]
Uveal Melanoma	DISA7ZGL	Strong	Altered Expression	[3]
Melanoma	DIS1RRCY	moderate	Biomarker	[4]
Testicular cancer	DIS6HNYO	moderate	Altered Expression	[2]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Sperm protein associated with the nucleus on the X chromosome C (SPANXC) affects the response to substance of Fluorouracil.	[8]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Sperm protein associated with the nucleus on the X chromosome C (SPANXC).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of Sperm protein associated with the nucleus on the X chromosome C (SPANXC).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Sperm protein associated with the nucleus on the X chromosome C (SPANXC).	[7]

References

• [1] Identification of the cancer/testis antigens AKAP3 and CTp11 by SEREX in hepatocellular carcinoma.Oncol Rep. 2012 Nov;28(5):1792-8. doi: 10.3892/or.2012.2002. Epub 2012 Aug 30.
• [2] Hypomethylation-activated cancer-testis gene SPANXC promotes cell metastasis in lung adenocarcinoma.J Cell Mol Med. 2019 Nov;23(11):7261-7267. doi: 10.1111/jcmm.14532. Epub 2019 Sep 4.
• [3] Immunoexpression of SPANX-C in metastatic uveal melanoma.Pathol Res Pract. 2019 Jul;215(7):152431. doi: 10.1016/j.prp.2019.04.023. Epub 2019 Apr 29.
• [4] SPANX-B and SPANX-C (Xq27 region) gene dosage analysis in Sicilian patients with melanoma.Melanoma Res. 2008 Aug;18(4):295-9. doi: 10.1097/CMR.0b013e32830aaa90.
• [5] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [8] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.