Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT13VWB7)

DOT Name	Probable ATP-dependent RNA helicase DDX49 (DDX49)
Synonyms	EC 3.6.4.13; DEAD box protein 49
Gene Name	DDX49
Related Disease	Lung cancer ( ) Lung carcinoma ( ) Metastatic malignant neoplasm ( ) Advanced cancer ( )
UniProt ID	DDX49_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.6.4.13
Pfam ID	PF00270 ; PF00271
Sequence	MAGFAELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPI LQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRK PHVVIATPGRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARR QTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTVEQLDQRYLLVPEKVKDAYLVHLIQ RFQDEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYR ILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLV HAIEEQIKKKLEEFSVEEAEVLQILTQVNVVRRECEIKLEAAHFDEKKEINKRKQLILEG KDPDLEAKRKAELAKIKQKNRRFKEKVEETLKRQKAGRAGHKGRPPRTPSGSHSGPVPSQ GLV
Reactome Pathway	Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226 ) rRNA modification in the nucleus and cytosol (R-HSA-6790901 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Lung cancer	DISCM4YA	Definitive	Biomarker	[1]
Lung carcinoma	DISTR26C	Definitive	Biomarker	[1]
Metastatic malignant neoplasm	DIS86UK6	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Probable ATP-dependent RNA helicase DDX49 (DDX49).	[3]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Probable ATP-dependent RNA helicase DDX49 (DDX49).	[9]
------------------------------------------------------------------------------------

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Probable ATP-dependent RNA helicase DDX49 (DDX49).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Probable ATP-dependent RNA helicase DDX49 (DDX49).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Probable ATP-dependent RNA helicase DDX49 (DDX49).	[6]
Selenium	DM25CGV	Approved	Selenium increases the expression of Probable ATP-dependent RNA helicase DDX49 (DDX49).	[7]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Probable ATP-dependent RNA helicase DDX49 (DDX49).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Probable ATP-dependent RNA helicase DDX49 (DDX49).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Probable ATP-dependent RNA helicase DDX49 (DDX49).	[11]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

References

1	DDX49 is a novel biomarker and therapeutic target for lung cancer metastases.J Cell Mol Med. 2020 Jan;24(1):1141-1145. doi: 10.1111/jcmm.14734. Epub 2019 Nov 20.
2	DDX49 is an RNA helicase that affects translation by regulating mRNA export and the levels of pre-ribosomal RNA.Nucleic Acids Res. 2018 Jul 6;46(12):6304-6317. doi: 10.1093/nar/gky231.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
8	Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
9	Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
10	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
11	Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.