| DOT Name |
Phospholipase A2 (PLA2G1B)
|
| Synonyms |
EC 3.1.1.4; Group IB phospholipase A2; Phosphatidylcholine 2-acylhydrolase 1B |
| Gene Name |
PLA2G1B
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
|
| EC Number |
|
| Pfam ID |
|
| Sequence |
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
|
| Function |
Secretory calcium-dependent phospholipase A2 that primarily targets dietary phospholipids in the intestinal tract. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism and inflammation in the intestinal tract. Hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines. May act in an autocrine and paracrine manner. Upon binding to the PLA2R1 receptor can regulate podocyte survival and glomerular homeostasis. Has anti-helminth activity in a process regulated by gut microbiota. Upon helminth infection of intestinal epithelia, directly affects phosphatidylethanolamine contents in the membrane of helminth larvae, likely controlling an array of phospholipid-mediated cellular processes such as membrane fusion and cell division while providing for better immune recognition, ultimately reducing larvae integrity and infectivity.
|
| Tissue Specificity |
Selectively expressed in pancreas, lung, liver and kidney. Also detected at lower levels in ovary and testis. |
| KEGG Pathway |
- Glycerophospholipid metabolism (hsa00564 )
- Ether lipid metabolism (hsa00565 )
- Arachidonic acid metabolism (hsa00590 )
- Linoleic acid metabolism (hsa00591 )
- alpha-Linolenic acid metabolism (hsa00592 )
- Metabolic pathways (hsa01100 )
- Ras sig.ling pathway (hsa04014 )
- Vascular smooth muscle contraction (hsa04270 )
- Pancreatic secretion (hsa04972 )
- Fat digestion and absorption (hsa04975 )
|
| Reactome Pathway |
- Acyl chain remodelling of PS (R-HSA-1482801 )
- Acyl chain remodelling of PE (R-HSA-1482839 )
- Acyl chain remodelling of PI (R-HSA-1482922 )
- Acyl chain remodelling of PG (R-HSA-1482925 )
- Synthesis of PA (R-HSA-1483166 )
- Acyl chain remodelling of PC (R-HSA-1482788 )
|
| BioCyc Pathway |
- MetaCyc:HS10199-MONOMER
|
|
|
|
|
|
|
