Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT244C1N)

DOT Name Protein transport protein Sec16B (SEC16B)
Synonyms Leucine zipper transcription regulator 2; Regucalcin gene promoter region-related protein p117; RGPR-p117; SEC16 homolog B
Gene Name SEC16B
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Congenital stationary night blindness 2A ( )
Niemann-Pick disease, type C1 ( )
UniProt ID
SC16B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12932 ; PF12931
Sequence
MELWAPQRLPQTRGKATAPSKDPDRGFRRDGHHRPVPHSWHNGERFHQWQDNRGSPQPQQ
EPRADHQQQPHYASRPGDWHQPVSGVDYYEGGYRNQLYSRPGYENSYQSYQSPTMREEYA
YGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSN
SRNPCKDSPASNSGQEWPGELFPGSLLAEAQKNKPSLASESNLLQQRESGLSSSSYELSQ
YIRDAPERDDPPASAAWSPVQADVSSAGPKAPMKFYIPHVPVSFGPGGQLVHVGPSSPTD
GQAALVELHSMEVILNDSEEQEEMRSFSGPLIREDVHKVDIMTFCQQKAAQSCKSETLGS
RDSALLWQLLVLLCRQNGSMVGSDIAELLMQDCKKLEKYKRQPPVANLINLTDEDWPVLS
SGTPNLLTGEIPPSVETPAQIVEKFTRLLYYGRKKEALEWAMKNHLWGHALFLSSKMDPQ
TYSWVMSGFTSTLALNDPLQTLFQLMSGRIPQAATCCGEKQWGDWRPHLAVILSNQAGDP
ELYQRAIVAIGDTLAGKGLVEAAHFCYLMAHVPFGHYTVKTDHLVLLGSSHSQEFLKFAT
TEAIQRTEIFEYCQMLGRPKSFIPSFQVYKLLYASRLADYGLVSQALHYCEAIGAAVLSQ
GESSHPVLLVELIKLAEKLKLSDPLVLERRSGDRDLEPDWLAQLRRQLEQKVAGDIGDPH
PTRSDISGAGGTTTENTFYQDFSGCQGYSEAPGYRSALWLTPEQTCLLQPSPQQPFPLQP
GSYPAGGGAGQTGTPRPFYSVPETHLPGTGSSVAVTEATGGTVWEEMLQTHLGPGENTVS
QETSQPPDGQEVISKPQTPLAARPRSISESSASSAKEDEKESSDEADKNSPRNTAQRGKL
GDGKEHTKSSGFGWFSWFRSKPTKNASPAGDEDSSDSPDSEETPRASSPHQAGLGLSLTP
SPESPPLPDVSAFSRGRGGGEGRGSASSGGAAAGAGVGGLSGPESVSFELCSNPGVLLPP
PALKGAVPLYNPSQVPQLPTATSLNRPNRLAQRRYPTQPC
Function
Plays a role in the organization of the endoplasmic reticulum exit sites (ERES), also known as transitional endoplasmic reticulum (tER). Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus. Involved in peroxisome biogenesis. Regulates the transport of peroxisomal biogenesis factors PEX3 and PEX16 from the ER to peroxisomes.
Tissue Specificity Ubiquitous.
Reactome Pathway
COPII-mediated vesicle transport (R-HSA-204005 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Genetic Variation [1]
Breast carcinoma DIS2UE88 Strong Genetic Variation [1]
Congenital stationary night blindness 2A DISA57KI Strong Genetic Variation [2]
Niemann-Pick disease, type C1 DIS9HUE3 Strong Biomarker [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Protein transport protein Sec16B (SEC16B). [4]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Protein transport protein Sec16B (SEC16B). [5]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Protein transport protein Sec16B (SEC16B). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Protein transport protein Sec16B (SEC16B). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Protein transport protein Sec16B (SEC16B). [8]
Triclosan DMZUR4N Approved Triclosan increases the expression of Protein transport protein Sec16B (SEC16B). [9]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Protein transport protein Sec16B (SEC16B). [10]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Protein transport protein Sec16B (SEC16B). [5]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Protein transport protein Sec16B (SEC16B). [13]
GW7647 DM9RD0C Investigative GW7647 increases the expression of Protein transport protein Sec16B (SEC16B). [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Protein transport protein Sec16B (SEC16B). [11]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Protein transport protein Sec16B (SEC16B). [12]
------------------------------------------------------------------------------------

References

1 Breast cancer family history and allele-specific DNA methylation in the legacy girls study.Epigenetics. 2018;13(3):240-250. doi: 10.1080/15592294.2018.1435243. Epub 2018 Apr 2.
2 Mutations in the CACNA1F and NYX genes in British CSNBX families. Hum Mutat. 2003 Feb;21(2):169. doi: 10.1002/humu.9106.
3 Association between obesity and polymorphisms in SEC16B, TMEM18, GNPDA2, BDNF, FAIM2 and MC4R in a Japanese population.J Hum Genet. 2009 Dec;54(12):727-31. doi: 10.1038/jhg.2009.106. Epub 2009 Oct 23.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
9 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
12 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
13 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
14 Identifying qualitative differences in PPAR signaling networks in human and rat hepatocytes and their significance for next generation chemical risk assessment methods. Toxicol In Vitro. 2020 Apr;64:104463. doi: 10.1016/j.tiv.2019.02.017. Epub 2019 Oct 15.