Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3NIKEQ)

• DOT Name: Transcription elongation factor A protein-like 8 (TCEAL8)
• Synonyms: TCEA-like protein 8; Transcription elongation factor S-II protein-like 8
• Gene Name: TCEAL8
• UniProt ID: TCAL8_HUMAN
• Pfam ID: PF04538
• Sequence:
  MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQG
  FKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP
• Function: May be involved in transcriptional regulation.

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Transcription elongation factor A protein-like 8 (TCEAL8).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Transcription elongation factor A protein-like 8 (TCEAL8).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Transcription elongation factor A protein-like 8 (TCEAL8).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Transcription elongation factor A protein-like 8 (TCEAL8).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Transcription elongation factor A protein-like 8 (TCEAL8).	[5]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Transcription elongation factor A protein-like 8 (TCEAL8).	[6]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Transcription elongation factor A protein-like 8 (TCEAL8).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Transcription elongation factor A protein-like 8 (TCEAL8).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Transcription elongation factor A protein-like 8 (TCEAL8).	[9]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Transcription elongation factor A protein-like 8 (TCEAL8).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Transcription elongation factor A protein-like 8 (TCEAL8).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Transcription elongation factor A protein-like 8 (TCEAL8).	[11]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [9] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [10] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [11] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [12] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.