Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3PSLDL)

DOT Name Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3)
Synonyms Natural killer-associated transcript 7; NKAT-7
Gene Name KIR2DS3
Related Disease
Nephropathy ( )
Chronic graft versus host disease ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
Idiopathic thrombocytopenic purpura ( )
Lymphoproliferative syndrome ( )
Systemic lupus erythematosus ( )
Systemic sclerosis ( )
Ulcerative colitis ( )
Pulmonary tuberculosis ( )
Small lymphocytic lymphoma ( )
Microscopic polyangiitis ( )
Rheumatoid arthritis ( )
UniProt ID
KI2S3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00047
Sequence
MSLMVISMACVGFFWLQGAWPHEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGT
FQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSDKKNASVMDQGPAGNRTVNREDSDEQDHQE
VSYA
Function Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
KEGG Pathway
Antigen processing and presentation (hsa04612 )
.tural killer cell mediated cytotoxicity (hsa04650 )

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Nephropathy DISXWP4P Definitive Biomarker [1]
Chronic graft versus host disease DIS1MM9J Strong Biomarker [2]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [3]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [3]
Idiopathic thrombocytopenic purpura DISFKGJU Strong Genetic Variation [4]
Lymphoproliferative syndrome DISMVL8O Strong Biomarker [3]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [5]
Systemic sclerosis DISF44L6 Strong Biomarker [5]
Ulcerative colitis DIS8K27O Strong Genetic Variation [6]
Pulmonary tuberculosis DIS6FLUM moderate Biomarker [7]
Small lymphocytic lymphoma DIS30POX moderate Biomarker [8]
Microscopic polyangiitis DIS74KSO Limited Biomarker [9]
Rheumatoid arthritis DISTSB4J Limited Genetic Variation [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3). [11]
------------------------------------------------------------------------------------

References

1 Analysis of killer cell immunoglobulin-like receptors and their human leukocyte antigen-ligands gene polymorphisms in Iranian patients with systemic lupus erythematosus.Lupus. 2016 Oct;25(11):1244-53. doi: 10.1177/0961203316638931. Epub 2016 Mar 16.
2 Donor-recipient combinations of group A and B KIR haplotypes and HLA class I ligand affect the outcome of HLA-matched, sibling donor hematopoietic cell transplantation.Hum Immunol. 2007 May;68(5):309-23. doi: 10.1016/j.humimm.2007.01.019. Epub 2007 Mar 12.
3 Genetic diversity of the KIR/HLA system and susceptibility to hepatitis C virus-related diseases.PLoS One. 2015 Feb 20;10(2):e0117420. doi: 10.1371/journal.pone.0117420. eCollection 2015.
4 The presence of KIR2DS5 confers protection against adult immune thrombocytopenia.Tissue Antigens. 2014 Mar;83(3):154-60. doi: 10.1111/tan.12295. Epub 2014 Feb 12.
5 The investigation of killer cell immunoglobulin-like receptor genotyping in patients with systemic lupus erytematosus and systemic sclerosis.Clin Rheumatol. 2016 Apr;35(4):919-25. doi: 10.1007/s10067-016-3222-0. Epub 2016 Mar 9.
6 Association between KIR-HLA combination and ulcerative colitis and Crohn's disease in a Japanese population.PLoS One. 2018 Apr 12;13(4):e0195778. doi: 10.1371/journal.pone.0195778. eCollection 2018.
7 Potential implication of activating killer cell immunoglobulin-like receptor and HLA in onset of pulmonary tuberculosis.Scand J Immunol. 2012 Nov;76(5):491-6. doi: 10.1111/j.1365-3083.2012.02762.x.
8 KIR/HLA gene combinations influence susceptibility to B-cell chronic lymphocytic leukemia and the clinical course of disease.Tissue Antigens. 2011 Aug;78(2):129-38. doi: 10.1111/j.1399-0039.2011.01721.x.
9 Association of killer cell immunoglobulin-like receptor genotypes with microscopic polyangiitis.Arthritis Rheum. 2006 Mar;54(3):992-7. doi: 10.1002/art.21653.
10 Associations of killer cell immunoglobulin like receptors with rheumatoid arthritis among North Indian population.Hum Immunol. 2014 Aug;75(8):802-7. doi: 10.1016/j.humimm.2014.05.014. Epub 2014 Jun 6.
11 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.