Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3RWMGH)

DOT Name	Late cornified envelope protein 3C (LCE3C)
Synonyms	Late envelope protein 15; Small proline-rich-like epidermal differentiation complex protein 3A
Gene Name	LCE3C
Related Disease	Autoimmune disease ( ) Palmoplantar pustulosis ( ) Systemic lupus erythematosus ( ) Immune system disorder ( ) Allergic contact dermatitis ( )
UniProt ID	LCE3C_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF14672
Sequence	MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHF RSHQCRRQRSNSCDRGSGQQGGGSCRGHGSGGCC
Function	A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to bacterial antigens.
Tissue Specificity	Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta.
Reactome Pathway	Formation of the cornified envelope (R-HSA-6809371 )

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[1]
Palmoplantar pustulosis	DISCNSWD	Strong	Biomarker	[2]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[3]
Immune system disorder	DISAEGPH	moderate	Biomarker	[4]
Allergic contact dermatitis	DISFFVF9	Limited	Genetic Variation	[5]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Late cornified envelope protein 3C (LCE3C).	[6]
------------------------------------------------------------------------------------

References

1	Worldwide population distribution of the common LCE3C-LCE3B deletion associated with psoriasis and other autoimmune disorders.BMC Genomics. 2013 Apr 17;14:261. doi: 10.1186/1471-2164-14-261.
2	Deletion of the late cornified envelope LCE3B and LCE3C genes as a susceptibility factor for psoriasis.Nat Genet. 2009 Feb;41(2):211-5. doi: 10.1038/ng.313. Epub 2009 Jan 25.
3	Deletion of LCE3C_LCE3B is associated with rheumatoid arthritis and systemic lupus erythematosus in the Chinese Han population.Ann Rheum Dis. 2011 Sep;70(9):1648-51. doi: 10.1136/ard.2010.148072. Epub 2011 May 30.
4	A replication study of the association between rheumatoid arthritis and deletion of the late cornified envelope genes LCE3B and LCE3C.PLoS One. 2012;7(2):e32045. doi: 10.1371/journal.pone.0032045. Epub 2012 Feb 23.
5	Deletion of the late cornified envelope genes LCE3B and LCE3C may promote chronic hand eczema with allergic contact dermatitis.J Investig Allergol Clin Immunol. 2011;21(6):472-9.
6	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.