Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT43QHS3)

DOT Name Transcription initiation factor TFIID subunit 7 (TAF7)
Synonyms RNA polymerase II TBP-associated factor subunit F; Transcription initiation factor TFIID 55 kDa subunit; TAF(II)55; TAFII-55; TAFII55
Gene Name TAF7
Related Disease
Breast cancer ( )
Breast carcinoma ( )
UniProt ID
TAF7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4RGW; 5FUR; 6MZL; 6MZM; 7EDX; 7EG7; 7EG8; 7EG9; 7EGA; 7EGB; 7EGC; 7EGD; 7EGE; 7EGH; 7EGI; 7EGJ; 7ENA; 7ENC; 8GXQ; 8GXS; 8WAK; 8WAL; 8WAN; 8WAO; 8WAP; 8WAQ; 8WAR; 8WAS
Pfam ID
PF04658
Sequence
MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDR
VPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASK
KKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTR
WEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQD
EEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAK
RQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK
Function
The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription. TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC). The TFIID complex consists of TBP and TBP-associated factors (TAFs), including TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13. TAF7 forms a promoter DNA binding subcomplex of TFIID, together with TAF1 and TAF2. Part of a TFIID complex containing TAF10 (TFIID alpha) and a TFIID complex lacking TAF10 (TFIID beta).
Tissue Specificity Ubiquitous.
KEGG Pathway
Basal transcription factors (hsa03022 )
Reactome Pathway
RNA Polymerase II HIV Promoter Escape (R-HSA-167162 )
Transcription of the HIV genome (R-HSA-167172 )
RNA Polymerase II Pre-transcription Events (R-HSA-674695 )
Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756 )
RNA Polymerase II Promoter Escape (R-HSA-73776 )
RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (R-HSA-73779 )
RNA Polymerase II Transcription Initiation (R-HSA-75953 )
RNA Polymerase II Transcription Initiation And Promoter Clearance (R-HSA-76042 )
HIV Transcription Initiation (R-HSA-167161 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Altered Expression [1]
Breast carcinoma DIS2UE88 Strong Altered Expression [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Transcription initiation factor TFIID subunit 7 (TAF7). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Transcription initiation factor TFIID subunit 7 (TAF7). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Transcription initiation factor TFIID subunit 7 (TAF7). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Transcription initiation factor TFIID subunit 7 (TAF7). [5]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Transcription initiation factor TFIID subunit 7 (TAF7). [8]
Ethanol DMDRQZU Approved Ethanol decreases the expression of Transcription initiation factor TFIID subunit 7 (TAF7). [9]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Transcription initiation factor TFIID subunit 7 (TAF7). [10]
Phenol DM1QSM3 Phase 2/3 Phenol decreases the expression of Transcription initiation factor TFIID subunit 7 (TAF7). [11]
PMID28870136-Compound-48 DMPIM9L Patented PMID28870136-Compound-48 decreases the expression of Transcription initiation factor TFIID subunit 7 (TAF7). [13]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Transcription initiation factor TFIID subunit 7 (TAF7). [14]
Resorcinol DMM37C0 Investigative Resorcinol increases the expression of Transcription initiation factor TFIID subunit 7 (TAF7). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Transcription initiation factor TFIID subunit 7 (TAF7). [6]
Quercetin DM3NC4M Approved Quercetin decreases the phosphorylation of Transcription initiation factor TFIID subunit 7 (TAF7). [7]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Transcription initiation factor TFIID subunit 7 (TAF7). [12]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Transcription initiation factor TFIID subunit 7 (TAF7). [7]
------------------------------------------------------------------------------------

References

1 MicroRNA-374c-5p inhibits the development of breast cancer through TATA-box binding protein associated factor 7-mediated transcriptional regulation of DEP domain containing 1.J Cell Biochem. 2019 Sep;120(9):15360-15368. doi: 10.1002/jcb.28803. Epub 2019 Jun 4.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
7 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
8 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
9 Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
12 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
13 Global expression profiling of theophylline response genes in macrophages: evidence of airway anti-inflammatory regulation. Respir Res. 2005 Aug 8;6(1):89. doi: 10.1186/1465-9921-6-89.
14 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
15 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.