General Information of Drug Off-Target (DOT) (ID: OT47CHQR)

DOT Name Spermatogenesis-associated protein 19, mitochondrial (SPATA19)
Synonyms Spermatogenic cell-specific gene 1 protein; Spergen-1
Gene Name SPATA19
Related Disease
Advanced cancer ( )
Benign prostatic hyperplasia ( )
Metastatic malignant neoplasm ( )
Neoplasm ( )
Prostate adenocarcinoma ( )
Prostate neoplasm ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
SPT19_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15212
Sequence
MIITTWIVYILARKGVGLPFLPITSSDIDVVESEAVSVLHHWLKKTEEEASRGIKEKLSI
NHPSQGVREKMSTDSPPTHGQDIHVTRDVVKHHLSKSDLLANQSQEVLEERTRIQFIRWS
HTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSSSDC
Function
Essential for sperm motility and male fertility. Plays an important role in sperm motility by regulating the organization and function of the mitochondria and is also required for correct sperm midpiece assembly.
Tissue Specificity Expressed specifically in testis.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Benign prostatic hyperplasia DISI3CW2 Strong Altered Expression [2]
Metastatic malignant neoplasm DIS86UK6 Strong Altered Expression [3]
Neoplasm DISZKGEW Strong Altered Expression [3]
Prostate adenocarcinoma DISBZYU8 Strong Biomarker [3]
Prostate neoplasm DISHDKGQ Strong Biomarker [3]
Prostate cancer DISF190Y moderate Altered Expression [2]
Prostate carcinoma DISMJPLE moderate Altered Expression [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Spermatogenesis-associated protein 19, mitochondrial (SPATA19). [4]
------------------------------------------------------------------------------------

References

1 Elevated expression levels of testis-specific genes TEX101 and SPATA19 in basal cell carcinoma and their correlation with clinical and pathological features.Br J Dermatol. 2010 Apr;162(4):772-9. doi: 10.1111/j.1365-2133.2009.09568.x. Epub 2009 Nov 3.
2 Cancer/testis antigen SPATA19 is frequently expressed in benign prostatic hyperplasia and prostate cancer.APMIS. 2017 Dec;125(12):1092-1101. doi: 10.1111/apm.12775. Epub 2017 Oct 3.
3 SPAS-1 (stimulator of prostatic adenocarcinoma-specific T cells)/SH3GLB2: A prostate tumor antigen identified by CTLA-4 blockade.Proc Natl Acad Sci U S A. 2008 Mar 4;105(9):3509-14. doi: 10.1073/pnas.0712269105. Epub 2008 Feb 26.
4 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.