Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4A0O1S)

• DOT Name: G protein-regulated inducer of neurite outgrowth 2 (GPRIN2)
• Synonyms: GRIN2
• Gene Name: GPRIN2
• Related Disease: Schizophrenia
• UniProt ID: GRIN2_HUMAN
• Pfam ID: PF15235
• Sequence:
  MSSSRPEPGPWAPLSPRLQPLSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQ
  APEEEGNPPESMKPARASGPKARPSAGGHWWSSTVGNVSTMGGSDLCRLRAPSAAAMQRS
  HSDLVRSTQMRGHSGARKASLSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLAPED
  ETSNSAWMLGASQLSVPPLDLGDTTAHSSSAQAEPKAAEQLATTTCHALPPAALLCGMRE
  VRAGGCCHALPATGILAFPKLVASVSESGLQAQHGVKIHCRLSGGLPGHSHCCAHLWGPA
  GLVPEPGSRTKDVWTMTSANDLAPAEASPLSAQDAGVQAAPVAACKAVATSPSLEAPAAL
  HVFPEVTLGSSLEEVPSPVRDVRWDAEGMTWEVYGAAVDLEVLGVAIQKHLEMQFEQLQR
  APASEDSLSVEGRRGPLRAVMQSLRRPSCCGCSGAAPE
• Function: May be involved in neurite outgrowth.
• Tissue Specificity: Expressed specifically in the cerebellum.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Schizophrenia	DISSRV2N	Strong	Biomarker	[1]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of G protein-regulated inducer of neurite outgrowth 2 (GPRIN2).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of G protein-regulated inducer of neurite outgrowth 2 (GPRIN2).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of G protein-regulated inducer of neurite outgrowth 2 (GPRIN2).	[6]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of G protein-regulated inducer of neurite outgrowth 2 (GPRIN2).	[3]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of G protein-regulated inducer of neurite outgrowth 2 (GPRIN2).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of G protein-regulated inducer of neurite outgrowth 2 (GPRIN2).	[7]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of G protein-regulated inducer of neurite outgrowth 2 (GPRIN2).	[8]

References

• [1] A pilot study on commonality and specificity of copy number variants in schizophrenia and bipolar disorder.Transl Psychiatry. 2016 May 31;6(5):e824. doi: 10.1038/tp.2016.96.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [4] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [8] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.