Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4A84VD)

• DOT Name: Homeobox even-skipped homolog protein 1 (EVX1)
• Synonyms: EVX-1
• Gene Name: EVX1
• Related Disease:
  Advanced cancer
  Esophageal squamous cell carcinoma
  Neoplasm
  Prostate cancer
  Prostate carcinoma
• UniProt ID: EVX1_HUMAN
• Pfam ID: PF00046
• Sequence:
  MESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRER
  GGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFY
  EEIEVSCTPDCATGNAEYQHSKGSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSAS
  DQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKR
  QRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPF
  SGSLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAGGPCSCLACHSGPANGL
  APRAAAASDFTCASTSRSDSFLTFAPSVLSKASSVALDQREEVPLTR
• Function: May play a role in the specification of neuronal cell types.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Prostate cancer	DISF190Y	Disputed	Biomarker	[2]
Prostate carcinoma	DISMJPLE	Disputed	Biomarker	[2]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Homeobox even-skipped homolog protein 1 (EVX1).	[3]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Homeobox even-skipped homolog protein 1 (EVX1).	[5]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Homeobox even-skipped homolog protein 1 (EVX1).	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Homeobox even-skipped homolog protein 1 (EVX1).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Homeobox even-skipped homolog protein 1 (EVX1).	[6]

References

• [1] Contribution of EVX1 in Aggressiveness of Esophageal Squamous Cell Carcinoma.Pathol Oncol Res. 2016 Apr;22(2):341-7. doi: 10.1007/s12253-015-0005-x. Epub 2015 Nov 9.
• [2] Using the epigenetic field defect to detect prostate cancer in biopsy negative patients.J Urol. 2013 Jun;189(6):2335-41. doi: 10.1016/j.juro.2012.11.074. Epub 2012 Nov 15.
• [3] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.