Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4BUBQU)

• DOT Name: DnaJ homolog subfamily C member 4 (DNAJC4)
• Synonyms: DnaJ-like protein HSPF2; Multiple endocrine neoplasia type 1 candidate protein number 18
• Gene Name: DNAJC4
• UniProt ID: DNJC4_HUMAN
• Pfam ID: PF00226
• Sequence:
  MPPLLPLRLCRLWPRNPPSRLLGAAAGQRSRPSTYYELLGVHPGASTEEVKRAFFSKSKE
  LHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQT
  HSSWTPPNAQYWSQFHSVRPQGPQLRQQQHKQNKQVLGYCLLLMLAGMGLHYIAFRKVKQ
  MHLNFMDEKDRIITAFYNEARARARANRGILQQERQRLGQRQPPPSEPTQGPEIVPRGAG
  P

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of DnaJ homolog subfamily C member 4 (DNAJC4).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of DnaJ homolog subfamily C member 4 (DNAJC4).	[6]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of DnaJ homolog subfamily C member 4 (DNAJC4).	[2]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of DnaJ homolog subfamily C member 4 (DNAJC4).	[3]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of DnaJ homolog subfamily C member 4 (DNAJC4).	[4]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of DnaJ homolog subfamily C member 4 (DNAJC4).	[5]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of DnaJ homolog subfamily C member 4 (DNAJC4).	[7]
Okadaic acid	DM47CO1	Investigative	Okadaic acid decreases the expression of DnaJ homolog subfamily C member 4 (DNAJC4).	[8]
L-Serine	DM6WPIS	Investigative	L-Serine increases the expression of DnaJ homolog subfamily C member 4 (DNAJC4).	[9]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [4] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [5] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Linking site-specific loss of histone acetylation to repression of gene expression by the mycotoxin ochratoxin A. Arch Toxicol. 2018 Feb;92(2):995-1014.
• [8] Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
• [9] Mechanisms of L-Serine Neuroprotection in vitro Include ER Proteostasis Regulation. Neurotox Res. 2018 Jan;33(1):123-132. doi: 10.1007/s12640-017-9829-3. Epub 2017 Nov 2.