Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4EDANR)

DOT Name Janus kinase and microtubule-interacting protein 3 (JAKMIP3)
Synonyms Neuroendocrine long coiled-coil protein 2
Gene Name JAKMIP3
Related Disease
Obesity ( )
Schizophrenia ( )
UniProt ID
JKIP3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF16034
Sequence
MSKRGMSSRAKGDKAEALAALQAANEDLRAKLTDIQIELQQEKSKVSKVEREKNQELRQV
REHEQHKTAVLLTELKTKLHEEKMKELQAVRETLLRQHEAELLRVIKIKDNENQRLQALL
SALRDGGPEKVKTVLLSEAKEEAKKGFEVEKVKMQQEISELKGAKRQVEEALTLVIQADK
IKAAEIRSVYHLHQEEITRIKKECEREIRRLMEEIKFKDRAVFVLERELGVQAGHAQRLQ
LQKEALDEQLSQVREADRHPGSPRRELPHAAGAGDASDHSGSPEQQLDEKDARRFQLKIA
ELSAIIRKLEDRNALLSEERNELLKRVREAESQYKPLLDKNKRLSRKNEDLSHALRRMEN
KLKFVTQENIEMRQRAGIIRRPSSLNDLDQSQDEREVDFLKLQIVEQQNLIDELSKTLET
AGYVKSVLERDKLLRFRKQRKKMAKLPKPVVVETFFGYDEEASLESDGSSVSYQTDRTDQ
TPCTPDDDLEEGMAKEETELRFRQLTMEYQALQRAYALLQEQVGGTLDAEREVKTREQLQ
AEVQRAQARIEDLEKALAEQGQDMKWIEEKQALYRRNQELVEKIKQMETEEARLRHEVQD
ARDQNELLEFRILELEERERKSPAISFHHTPFVDGKSPLQVYCEAEGVTDIVVAELMKKL
DILGDNANLTNEEQVVVIQARTVLTLAEKWLQQIEETEAALQRKMVDLESEKELFSKQKG
YLDEELDYRKQALDQANKHILELEAMLYDALQQEAGAKVAELLSEEEREKLKVAVEQWKR
QVMSELRERDAQILRERMELLQLAQQRIKELEERIEAQKRQIKELEEKFLFLFLFFSLAF
ILWS
Tissue Specificity Specifically expressed in the CNS and endocrine tissues. Also detected in other tissues including heart, testis and prostate.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Obesity DIS47Y1K Strong Biomarker [1]
Schizophrenia DISSRV2N Strong Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Janus kinase and microtubule-interacting protein 3 (JAKMIP3). [3]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Janus kinase and microtubule-interacting protein 3 (JAKMIP3). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Janus kinase and microtubule-interacting protein 3 (JAKMIP3). [8]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Janus kinase and microtubule-interacting protein 3 (JAKMIP3). [10]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Janus kinase and microtubule-interacting protein 3 (JAKMIP3). [5]
Melphalan DMOLNHF Approved Melphalan decreases the expression of Janus kinase and microtubule-interacting protein 3 (JAKMIP3). [6]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Janus kinase and microtubule-interacting protein 3 (JAKMIP3). [7]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Janus kinase and microtubule-interacting protein 3 (JAKMIP3). [9]
------------------------------------------------------------------------------------

References

1 The caveolae-associated coiled-coil protein, NECC2, regulates insulin signalling in Adipocytes.J Cell Mol Med. 2018 Nov;22(11):5648-5661. doi: 10.1111/jcmm.13840. Epub 2018 Aug 30.
2 A molecular pathway analysis informs the genetic risk for arrhythmias during antipsychotic treatment.Int Clin Psychopharmacol. 2018 Jan;33(1):1-14. doi: 10.1097/YIC.0000000000000198.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
5 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
6 Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
7 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
10 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.