Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4WJKTF)

• DOT Name: Lung adenoma susceptibility protein 2 (C18ORF54)
• Gene Name: C18ORF54
• Related Disease:
  Lung adenocarcinoma
  Lung neoplasm
  Neoplasm
• UniProt ID: LAS2_HUMAN
• Pfam ID: PF15792
• Sequence:
  MAKSKTKHRLCSQESSVSALLASCTLSGSNSSNSDGSFHYKDKLYRSASQALQAYIDDFD
  LGQIYPGASTGKINIDEDFTNMSQFCNYIYKPNNAFENLDHKKHSNFISCRRHTVNDIDS
  MSLTTDDLLRLPADGSFSYTYVGPSHRTSKKNKKCRGRLGSLDIEKNPHFQGPYTSMGKD
  NFVTPVIRSNINGKQCGDKIELLILKAKRNLEQCTEELPKSMKKDDSPCSLDKLEADRSW
  ENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLNNDNQSCTLSGGKHHGPVEALKQM
  LFNLQAVQERFNQNKTTDPKEEIKQVSEDDFSKLQLKESMIPITRSLQKALHHLSRLRDL
  VDDTNGERSPKM
• Function: Might play a role in cell proliferation.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Definitive	Genetic Variation	[1]
Lung neoplasm	DISVARNB	Definitive	Genetic Variation	[1]
Neoplasm	DISZKGEW	Definitive	Genetic Variation	[1]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[4]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[7]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[7]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[8]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[10]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Lung adenoma susceptibility protein 2 (C18ORF54).	[12]

References

• [1] Identification of Las2, a major modifier gene affecting the Pas1 mouse lung tumor susceptibility locus.Cancer Res. 2009 Aug 1;69(15):6290-8. doi: 10.1158/0008-5472.CAN-09-0782. Epub 2009 Jul 21.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [8] Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
• [9] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [10] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [11] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [12] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.