Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4XOG70)

DOT Name F-box only protein 24 (FBXO24)
Gene Name FBXO24
Related Disease
Gastric cancer ( )
Stomach cancer ( )
UniProt ID
FBX24_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12937 ; PF00415
Sequence
MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLV
ALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPWKRAAILNYTKGLYFQAFGGR
RRCLSKSVAPLLAHGYRRFLPTKDHVFILDYVGTLFFLKNALVSTLGQMQWKRACRYVVL
CRGAKDFASDPRCDTVYRKYLYVLATREPQEVVGTTSSRACDCVEVYLQSSGQRVFKMTF
HHSMTFKQIVLVGQETQRALLLLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPH
LRVACMTSNQSSTLYVTDQGGVYFEVHTPGVYRDLFGTLQAFDPLDQQMPLALSLPAKIL
FCALGYNHLGLVDEFGRIFMQGNNRYGQLGTGDKMDRGEPTQVCYLQRPITLWCGLNHSL
VLSQSSEFSKELLGCGCGAGGRLPGWPKGSASFVKLQVKVPLCACALCATRECLYILSSH
DIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMAQACEEYLSQIHSCQTLQDRTEKMK
EIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPET
Function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Gastric cancer DISXGOUK Strong Biomarker [1]
Stomach cancer DISKIJSX Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of F-box only protein 24 (FBXO24). [2]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of F-box only protein 24 (FBXO24). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of F-box only protein 24 (FBXO24). [4]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of F-box only protein 24 (FBXO24). [5]
Triclosan DMZUR4N Approved Triclosan increases the expression of F-box only protein 24 (FBXO24). [6]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of F-box only protein 24 (FBXO24). [7]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of F-box only protein 24 (FBXO24). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Exome sequencing reveals three novel candidate predisposition genes for diffuse gastric cancer.Fam Cancer. 2015 Jun;14(2):241-6. doi: 10.1007/s10689-015-9778-z.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
5 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
6 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
7 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
8 Cultured human peripheral blood mononuclear cells alter their gene expression when challenged with endocrine-disrupting chemicals. Toxicology. 2013 Jan 7;303:17-24.