Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5GA6JZ)

• DOT Name: Stress-associated endoplasmic reticulum protein 2 (SERP2)
• Synonyms: Ribosome-associated membrane protein RAMP4-2
• Gene Name: SERP2
• Related Disease:
  Advanced cancer
  leukaemia
  Leukemia
• UniProt ID: SERP2_HUMAN
• Pfam ID: PF06624
• Sequence:
  MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQS
  IRMGM
• Function: Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
leukaemia	DISS7D1V	Strong	Genetic Variation	[2]
Leukemia	DISNAKFL	Strong	Genetic Variation	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Stress-associated endoplasmic reticulum protein 2 (SERP2).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Stress-associated endoplasmic reticulum protein 2 (SERP2).	[8]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Stress-associated endoplasmic reticulum protein 2 (SERP2).	[4]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Stress-associated endoplasmic reticulum protein 2 (SERP2).	[5]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Stress-associated endoplasmic reticulum protein 2 (SERP2).	[6]
Fenfluramine	DM0762O	Phase 3	Fenfluramine decreases the expression of Stress-associated endoplasmic reticulum protein 2 (SERP2).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Stress-associated endoplasmic reticulum protein 2 (SERP2).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Stress-associated endoplasmic reticulum protein 2 (SERP2).	[10]

References

• [1] Safety of an Oncolytic Myxoma Virus in Dogs with Soft Tissue Sarcoma.Viruses. 2018 Jul 28;10(8):398. doi: 10.3390/v10080398.
• [2] High frequency of BTG1 deletions in acute lymphoblastic leukemia in children with down syndrome.Genes Chromosomes Cancer. 2012 Feb;51(2):196-206. doi: 10.1002/gcc.20944. Epub 2011 Nov 10.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [6] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [7] Fenfluramine-induced gene dysregulation in human pulmonary artery smooth muscle and endothelial cells. Pulm Circ. 2011 Jul-Sep;1(3):405-18. doi: 10.4103/2045-8932.87310.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [10] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.