Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5LSKCS)

• DOT Name: Esterase OVCA2 (OVCA2)
• Synonyms: EC 3.1.2.-; Ovarian cancer-associated gene 2 protein
• Gene Name: OVCA2
• Related Disease:
  Lung cancer
  Lung carcinoma
  Medulloblastoma
  Neoplasm
  Promyelocytic leukaemia
  Acute myelogenous leukaemia
• UniProt ID: OVCA2_HUMAN
• EC Number: 3.1.2.-
• Pfam ID: PF03959
• Sequence:
  MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSD
  FGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQ
  GAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDK
  VIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE
• Tissue Specificity: Ubiquitously expressed.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Strong	Altered Expression	[1]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[1]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Biomarker	[3]
Promyelocytic leukaemia	DISYGG13	Strong	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[4]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaldehyde	DMJFKG4	Investigative	Esterase OVCA2 (OVCA2) increases the response to substance of Acetaldehyde.	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Esterase OVCA2 (OVCA2).	[5]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Esterase OVCA2 (OVCA2).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Esterase OVCA2 (OVCA2).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Esterase OVCA2 (OVCA2).	[8]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Esterase OVCA2 (OVCA2).	[9]

References

• [1] OVCA2 is downregulated and degraded during retinoid-induced apoptosis.Int J Cancer. 2002 May 10;99(2):185-92. doi: 10.1002/ijc.10334.
• [2] Mass spectrometric identification of serine hydrolase OVCA2 in the medulloblastoma cell line DAOY.Cancer Lett. 2006 Sep 28;241(2):235-49. doi: 10.1016/j.canlet.2005.10.023. Epub 2005 Dec 20.
• [3] FSH3 mediated cell death is dependent on NUC1 in Saccharomyces cerevisiae.FEMS Yeast Res. 2019 May 1;19(3):foz017. doi: 10.1093/femsyr/foz017.
• [4] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [10] Genome-Wide CRISPR Screening Identifies the Tumor Suppressor Candidate OVCA2 As a Determinant of Tolerance to Acetaldehyde. Toxicol Sci. 2019 May 1;169(1):235-245. doi: 10.1093/toxsci/kfz037.