Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT64DNLW)

• DOT Name: Photoreceptor disk component PRCD (PRCD)
• Synonyms: Progressive rod-cone degeneration protein
• Gene Name: PRCD
• Related Disease:
  Retinitis pigmentosa 36
  Blindness
  Neuronal ceroid lipofuscinosis
  Retinitis pigmentosa 17
  Retinitis pigmentosa
  Neoplasm
• UniProt ID: PRCD_HUMAN
• Pfam ID: PF15201
• Sequence: MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK
• Function: Involved in vision.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Retinitis pigmentosa 36	DIS34IFD	Definitive	Autosomal recessive	[1]
Blindness	DISTIM10	Strong	Genetic Variation	[2]
Neuronal ceroid lipofuscinosis	DIS9A4K4	Strong	Genetic Variation	[3]
Retinitis pigmentosa 17	DIS7LCIM	Strong	Genetic Variation	[4]
Retinitis pigmentosa	DISCGPY8	Supportive	Autosomal dominant	[5]
Neoplasm	DISZKGEW	Limited	Biomarker	[6]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Photoreceptor disk component PRCD (PRCD).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Photoreceptor disk component PRCD (PRCD).	[11]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Photoreceptor disk component PRCD (PRCD).	[8]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Photoreceptor disk component PRCD (PRCD).	[9]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Photoreceptor disk component PRCD (PRCD).	[10]

References

• [1] Identification of a prevalent founder mutation in an Israeli Muslim Arab village confirms the role of PRCD in the aetiology of retinitis pigmentosa in humans. J Med Genet. 2010 Aug;47(8):533-7. doi: 10.1136/jmg.2009.073619. Epub 2010 May 27.
• [2] PRCD is essential for high-fidelity photoreceptor disc formation.Proc Natl Acad Sci U S A. 2019 Jun 25;116(26):13087-13096. doi: 10.1073/pnas.1906421116. Epub 2019 Jun 12.
• [3] Electroretinograms in English setters with neuronal ceroid lipofuscinosis.Invest Ophthalmol Vis Sci. 1980 Jan;19(1):87-90.
• [4] Linkage analysis and comparative mapping of canine progressive rod-cone degeneration (prcd) establishes potential locus homology with retinitis pigmentosa (RP17) in humans.Proc Natl Acad Sci U S A. 1998 Mar 17;95(6):3048-53. doi: 10.1073/pnas.95.6.3048.
• [5] Nonsyndromic Retinitis Pigmentosa Overview. 2000 Aug 4 [updated 2023 Apr 6]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [6] Chromosome 17q25 genes, RHBDF2 and CYGB, in ovarian cancer.Int J Oncol. 2012 Jun;40(6):1865-80. doi: 10.3892/ijo.2012.1371. Epub 2012 Feb 14.
• [7] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [8] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [9] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [10] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [11] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.