Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6UFQCL)

• DOT Name: Probable G-protein coupled receptor 142 (GPR142)
• Synonyms: G-protein coupled receptor PGR2
• Gene Name: GPR142
• Related Disease:
  Hyperglycemia
  Non-insulin dependent diabetes
  Type-1/2 diabetes
• UniProt ID: GP142_HUMAN
• Pfam ID: PF00001
• Sequence:
  MSIMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSHSRWLRSPQ
  VTGGSWDLRIRPSKDSSSFRQAQCLRKDPGANNHLESQGVRGTAGDADRELRGPSEKATA
  GQPRVTLLPTPHVSGLSQEFESHWPEIAERSPCVAGVIPVIYYSVLLGLGLPVSLLTAVA
  LARLATRTRRPSYYYLLALTASDIIIQVVIVFAGFLLQGAVLARQVPQAVVRTANILEFA
  ANHASVWIAILLTVDRYTALCHPLHHRAASSPGRTRRAIAAVLSAALLTGIPFYWWLDMW
  RDTDSPRTLDEVLKWAHCLTVYFIPCGVFLVTNSAIIHRLRRRGRSGLQPRVGKSTAILL
  GITTLFTLLWAPRVFVMLYHMYVAPVHRDWRVHLALDVANMVAMLHTAANFGLYCFVSKT
  FRATVRQVIHDAYLPCTLASQPEGMAAKPVMEPPGLPTGAEV
• Function: Orphan receptor.
• Tissue Specificity: Exclusively expressed in the central nervous system, most abundantly in the ventrolateral region of caudate putamen, the habenular nucleus, the zona incerta, and the medial mammillary nucleus.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[1]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[2]
Type-1/2 diabetes	DISIUHAP	Disputed	Biomarker	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Probable G-protein coupled receptor 142 (GPR142).	[3]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Probable G-protein coupled receptor 142 (GPR142).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Probable G-protein coupled receptor 142 (GPR142).	[4]

References

• [1] The functional impact of G protein-coupled receptor 142 (Gpr142) on pancreatic -cell in rodent.Pflugers Arch. 2019 Apr;471(4):633-645. doi: 10.1007/s00424-019-02262-7. Epub 2019 Feb 15.
• [2] GPR142 prompts glucagon-like Peptide-1 release from islets to improve cell function.Mol Metab. 2018 May;11:205-211. doi: 10.1016/j.molmet.2018.02.008. Epub 2018 Feb 23.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.