Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT77JDB7)

• DOT Name: Putative RNA-binding protein Luc7-like 1 (LUC7L)
• Synonyms: Putative SR protein LUC7B1; SR+89
• Gene Name: LUC7L
• Related Disease:
  Malaria
  Alpha thalassemia
  Anemia
• UniProt ID: LUC7L_HUMAN
• Pfam ID: PF03194
• Sequence:
  MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECT
  KIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS
  AKAEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS
  SFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQLRKTVAEKQEKRN
  QDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHR
  RHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWRLESSNGKMAS
  RRSEEKEAGEI
• Function: May bind to RNA via its Arg/Ser-rich domain.
• Tissue Specificity: Ubiquitous.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Malaria	DISQ9Y50	Definitive	Genetic Variation	[1]
Alpha thalassemia	DIS5XGK0	Strong	Genetic Variation	[2]
Anemia	DISTVL0C	Strong	Genetic Variation	[2]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[7]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[8]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[13]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[14]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[15]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[10]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[12]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Putative RNA-binding protein Luc7-like 1 (LUC7L).	[12]

References

• [1] High Incidence of Malaria Along the Sino-Burmese Border Is Associated With Polymorphisms of CR1, IL-1A, IL-4R, IL-4, NOS, and TNF, But Not With G6PD Deficiency.Medicine (Baltimore). 2015 Oct;94(40):e1681. doi: 10.1097/MD.0000000000001681.
• [2] Transcription of antisense RNA leading to gene silencing and methylation as a novel cause of human genetic disease.Nat Genet. 2003 Jun;34(2):157-65. doi: 10.1038/ng1157.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [8] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [9] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [13] Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
• [14] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [15] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.