General Information of Drug Off-Target (DOT) (ID: OT78O9LF)

DOT Name ATR-interacting protein (ATRIP)
Synonyms ATM and Rad3-related-interacting protein
Gene Name ATRIP
Related Disease
Prostate cancer ( )
Prostate carcinoma ( )
Advanced cancer ( )
Aicardi-Goutieres syndrome ( )
Aicardi-Goutieres syndrome 1 ( )
Ataxia-telangiectasia ( )
Chilblain lupus 1 ( )
Mantle cell lymphoma ( )
Retinal vasculopathy with cerebral leukoencephalopathy and systemic manifestations ( )
Epithelial ovarian cancer ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Seckel syndrome ( )
UniProt ID
ATRIP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4IGK; 4NB3; 5YZ0; 7XV4
Sequence
MAGTSAPGSKRRSEPPAPRPGPPPGTGHPPSKRARGFSAAAAPDPDDPFGAHGDFTADDL
EELDTLASQALSQCPAAARDVSSDHKVHRLLDGMSKNPSGKNRETVPIKDNFELEVLQAQ
YKELKEKMKVMEEEVLIKNGEIKILRDSLHQTESVLEEQRRSHFLLEQEKTQALSDKEKE
FSKKLQSLQSELQFKDAEMNELRTKLQTSERANKLAAPSVSHVSPRKNPSVVIKPEACSP
QFGKTSFPTKESFSANMSLPHPCQTESGYKPLVGREDSKPHSLRGDSIKQEEAQKSFVDS
WRQRSNTQGSILINLLLKQPLIPGSSLSLCHLLSSSSESPAGTPLQPPGFGSTLAGMSGL
RTTGSYDGSFSLSALREAQNLAFTGLNLVARNECSRDGDPAEGGRRAFPLCQLPGAVHFL
PLVQFFIGLHCQALQDLAAAKRSGAPGDSPTHSSCVSSGVETNPEDSVCILEGFSVTALS
ILQHLVCHSGAVVSLLLSGVGADSAAGEGNRSLVHRLSDGDMTSALRGVADDQGQHPLLK
MLLHLLAFSSAATGHLQASVLTQCLKVLVKLAENTSCDFLPRFQCVFQVLPKCLSPETPL
PSVLLAVELLSLLADHDQLAPQLCSHSEGCLLLLLYMYITSRPDRVALETQWLQLEQEVV
WLLAKLGVQSPLPPVTGSNCQCNVEVVRALTVMLHRQWLTVRRAGGPPRTDQQRRTVRCL
RDTVLLLHGLSQKDKLFMMHCVEVLHQFDQVMPGVSMLIRGLPDVTDCEEAALDDLCAAE
TDVEDPEVECG
Function Required for checkpoint signaling after DNA damage. Required for ATR expression, possibly by stabilizing the protein.
Tissue Specificity Ubiquitous.
KEGG Pathway
Fanconi anemia pathway (hsa03460 )
Reactome Pathway
HDR through Single Strand Annealing (SSA) (R-HSA-5685938 )
Processing of DNA double-strand break ends (R-HSA-5693607 )
Presynaptic phase of homologous DNA pairing and strand exchange (R-HSA-5693616 )
Fanconi Anemia Pathway (R-HSA-6783310 )
Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756 )
G2/M DNA damage checkpoint (R-HSA-69473 )
Impaired BRCA2 binding to RAD51 (R-HSA-9709570 )
Activation of ATR in response to replication stress (R-HSA-176187 )

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Prostate cancer DISF190Y Definitive Biomarker [1]
Prostate carcinoma DISMJPLE Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Biomarker [2]
Aicardi-Goutieres syndrome DIS1NH4X Strong Genetic Variation [3]
Aicardi-Goutieres syndrome 1 DISPAXC2 Strong CausalMutation [4]
Ataxia-telangiectasia DISP3EVR Strong Biomarker [5]
Chilblain lupus 1 DISEBS1O Strong CausalMutation [4]
Mantle cell lymphoma DISFREOV Strong Posttranslational Modification [6]
Retinal vasculopathy with cerebral leukoencephalopathy and systemic manifestations DISI621C Strong CausalMutation [4]
Epithelial ovarian cancer DIS56MH2 moderate Biomarker [7]
Ovarian cancer DISZJHAP moderate Biomarker [7]
Ovarian neoplasm DISEAFTY moderate Biomarker [7]
Seckel syndrome DISEVUBA Supportive Autosomal recessive [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of ATR-interacting protein (ATRIP). [9]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of ATR-interacting protein (ATRIP). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of ATR-interacting protein (ATRIP). [14]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of ATR-interacting protein (ATRIP). [16]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of ATR-interacting protein (ATRIP). [10]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of ATR-interacting protein (ATRIP). [12]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of ATR-interacting protein (ATRIP). [13]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of ATR-interacting protein (ATRIP). [15]
------------------------------------------------------------------------------------

References

1 Searching for candidate genes in familial BRCAX mutation carriers with prostate cancer.Urol Oncol. 2016 Mar;34(3):120.e9-16. doi: 10.1016/j.urolonc.2015.10.009. Epub 2015 Nov 14.
2 Human gastric adenocarcinoma cathepsin B: isolation and sequencing of full-length cDNAs and polymorphisms of the gene.Gene. 1994 Feb 25;139(2):163-9. doi: 10.1016/0378-1119(94)90750-1.
3 Heterozygous mutations in TREX1 cause familial chilblain lupus and dominant Aicardi-Goutieres syndrome. Am J Hum Genet. 2007 Apr;80(4):811-5. doi: 10.1086/513443. Epub 2007 Feb 19.
4 Inflammatory myopathy in a patient with Aicardi-Goutires syndrome.Eur J Med Genet. 2017 Mar;60(3):154-158. doi: 10.1016/j.ejmg.2016.12.004. Epub 2017 Jan 9.
5 Colonic Lysine Homocysteinylation Induced by High-Fat Diet Suppresses DNA Damage Repair.Cell Rep. 2018 Oct 9;25(2):398-412.e6. doi: 10.1016/j.celrep.2018.09.022.
6 The interaction between ATRIP and MCM complex is essential for ATRIP chromatin loading and its phosphorylation in mantle cell lymphoma cells.Pharmazie. 2017 Nov 1;72(11):670-673. doi: 10.1691/ph.2017.7676.
7 Phosphorylation of ATR-interacting protein on Ser239 mediates an interaction with breast-ovarian cancer susceptibility 1 and checkpoint function.Cancer Res. 2007 Jul 1;67(13):6100-5. doi: 10.1158/0008-5472.CAN-07-0369.
8 Identification of the first ATRIP-deficient patient and novel mutations in ATR define a clinical spectrum for ATR-ATRIP Seckel Syndrome. PLoS Genet. 2012;8(11):e1002945. doi: 10.1371/journal.pgen.1002945. Epub 2012 Nov 8.
9 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
10 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
11 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
12 Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
13 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
14 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
15 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
16 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.