| DOT Name |
Charged multivesicular body protein 4b (CHMP4B)
|
| Synonyms |
Chromatin-modifying protein 4b; CHMP4b; SNF7 homolog associated with Alix 1; SNF7-2; hSnf7-2; Vacuolar protein sorting-associated protein 32-2; Vps32-2; hVps32-2 |
| Gene Name |
CHMP4B
|
| Related Disease |
- Cataract 31 multiple types ( )
- Early-onset posterior polar cataract ( )
- Early-onset posterior subcapsular cataract ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
|
| Pfam ID |
|
| Sequence |
MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTK
NKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
DNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNL
LEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM
|
| Function |
Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Together with SPAST, the ESCRT-III complex promotes nuclear envelope sealing and mitotic spindle disassembly during late anaphase. Plays a role in the endosomal sorting pathway. ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. When overexpressed, membrane-assembled circular arrays of CHMP4B filaments can promote or stabilize negative curvature and outward budding. CHMP4A/B/C are required for the exosomal release of SDCBP, CD63 and syndecan. Majority of the protein exists in a folded closed conformation ; (Microbial infection) The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the budding of enveloped viruses (HIV-1 and other lentiviruses). Via its interaction with PDCD6IP involved in HIV-1 p6- and p9-dependent virus release.
|
| Tissue Specificity |
Widely expressed. Expressed at higher level in heart and skeletal muscle. Also expressed in brain, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood lymphocytes.
|
| KEGG Pathway |
- Viral life cycle - HIV-1 (hsa03250 )
- Endocytosis (hsa04144 )
- Necroptosis (hsa04217 )
|
| Reactome Pathway |
- Macroautophagy (R-HSA-1632852 )
- Pyroptosis (R-HSA-5620971 )
- Endosomal Sorting Complex Required For Transport (ESCRT) (R-HSA-917729 )
- HCMV Late Events (R-HSA-9610379 )
- Late endosomal microautophagy (R-HSA-9615710 )
- Sealing of the nuclear envelope (NE) by ESCRT-III (R-HSA-9668328 )
- Translation of Replicase and Assembly of the Replication Transcription Complex (R-HSA-9679504 )
- Translation of Replicase and Assembly of the Replication Transcription Complex (R-HSA-9694676 )
- Budding and maturation of HIV virion (R-HSA-162588 )
|
|
|
|
|
|
|
