Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8KGE9M)

• DOT Name: Follicular dendritic cell secreted peptide (FDCSP)
• Synonyms: FDC secreted protein; FDC-SP
• Gene Name: FDCSP
• Related Disease:
  Crohn disease
  IgA nephropathy
  Metabolic disorder
  Periodontal disease
  Advanced cancer
  Epithelial ovarian cancer
  Metastatic malignant neoplasm
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
• UniProt ID: FDSCP_HUMAN
• Pfam ID: PF15215
• Sequence:
  MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPR
  FPWFRRNFPIPIPESAPTTPLPSEK
• Function: Can bind to the surface of B-lymphoma cells, but not T-lymphoma cells, consistent with a function as a secreted mediator acting upon B-cells.
• Tissue Specificity: Abundantly expressed in tonsil, lymph node, and trachea; strong expression in prostate; lower expression in thyroid, stomach, and colon.

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Crohn disease	DIS2C5Q8	Definitive	Altered Expression	[1]
IgA nephropathy	DISZ8MTK	Strong	Biomarker	[2]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[3]
Periodontal disease	DISJQHVN	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[4]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[4]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[4]
Neoplasm	DISZKGEW	Limited	Biomarker	[5]
Ovarian cancer	DISZJHAP	Limited	Biomarker	[4]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Follicular dendritic cell secreted peptide (FDCSP).	[6]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of Follicular dendritic cell secreted peptide (FDCSP).	[7]

References

• [1] NOD2 status and human ileal gene expression.Inflamm Bowel Dis. 2010 Oct;16(10):1649-57. doi: 10.1002/ibd.21208.
• [2] Decreased expression of follicular dendritic cell-secreted protein correlates with increased immunoglobulin A production in the tonsils of individuals with immunoglobulin A nephropathy.Transl Res. 2015 Sep;166(3):281-91. doi: 10.1016/j.trsl.2015.04.004. Epub 2015 Apr 17.
• [3] C4orf7 modulates osteogenesis and adipogenesis of human periodontal ligament cells.Am J Transl Res. 2017 Dec 15;9(12):5708-5718. eCollection 2017.
• [4] C4orf7 contributes to ovarian cancer metastasis by promoting cancer cell migration and invasion.Oncol Rep. 2010 Oct;24(4):933-9.
• [5] Identification of novel follicular dendritic cell sarcoma markers, FDCSP and SRGN, by whole transcriptome sequencing.Oncotarget. 2017 Mar 7;8(10):16463-16472. doi: 10.18632/oncotarget.14864.
• [6] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [7] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.