Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8P9T93)

• DOT Name: Synapse differentiation-inducing gene protein 1 (SYNDIG1)
• Synonyms: SynDIG1; Dispanin subfamily C member 2; DSPC2; Transmembrane protein 90B
• Gene Name: SYNDIG1
• Related Disease:
  Schizophrenia
  Tourette syndrome
• UniProt ID: SYNG1_HUMAN
• Pfam ID: PF04505
• Sequence:
  MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYPAPQYQSHRVGASTVPA
  SLDSSRSEPMQQLLDPNTLQQSVESRYRPNIILYSEGVLRSWGDGVAADCCETTFIEDRS
  PTKDSLEYPDGKFIDLSADDIKIHTLSYDVEEEEEFQELESDYSSDTESEDNFLMMPPRD
  HLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDLHQASTSSRRALFLAVLSITIGTGV
  YVGVAVALIAYLSKNNHL
• Function: May regulate AMPA receptor content at nascent synapses, and have a role in postsynaptic development and maturation.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Schizophrenia	DISSRV2N	Strong	Biomarker	[1]
Tourette syndrome	DISX9D54	No Known	Unknown	[2]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Synapse differentiation-inducing gene protein 1 (SYNDIG1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Synapse differentiation-inducing gene protein 1 (SYNDIG1).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Synapse differentiation-inducing gene protein 1 (SYNDIG1).	[5]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Synapse differentiation-inducing gene protein 1 (SYNDIG1).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Synapse differentiation-inducing gene protein 1 (SYNDIG1).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Synapse differentiation-inducing gene protein 1 (SYNDIG1).	[8]

References

• [1] Comprehensive gene-based association study of a chromosome 20 linked region implicates novel risk loci for depressive symptoms in psychotic illness.PLoS One. 2011;6(12):e21440. doi: 10.1371/journal.pone.0021440. Epub 2011 Dec 29.
• [2] De Novo Coding Variants Are Strongly Associated with Tourette Disorder. Neuron. 2017 May 3;94(3):486-499.e9. doi: 10.1016/j.neuron.2017.04.024.
• [3] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [7] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.